Welcome to WormBase - need help?
Questions, Feedback & Help
Send us an email and we'll get back to you ASAP. Or you can read our Frequently Asked Questions.

Legend

default*XZ
unknown.
hydrophobicAGLMPV
large hydrophobicFHWY
small alcoholST
cysteineC
negativeDE
polarNQ
positive chargeKR

Protein Alignments

This is the Wormbase protein aligner. To use it, enter a WormBase protein ID.


(e.g. CE25115 or CBP00571)

RP26668(Caenorhabditis remanei)CRE03833 Cre-unc-40
JA57681(Caenorhabditis japonica)CJA07019b Cjp-unc-40
TMP09698(Trichuris muris)TMUE_1000005482
CN16484(Caenorhabditis brenneri)CBN24134 Cbn-unc-40.2
CBP38503(Caenorhabditis briggsae)CBG14917d Cbr-unc-40
OVP04334(Onchocerca volvulus)OVOC1550 Ovo-unc-40
SRP08301(Strongyloides ratti)SRAE_2000245100
BM45234(Brugia malayi)Bm5833
PP54034(Pristionchus pacificus)PPA23657
ENSEMBL:ENSP00000389140(Homo sapiens)Netrin receptor DCC
SW:P70211(Mus musculus)Netrin receptor DCC
FLYBASE:CG8581(Drosophila melanogaster)Flybase gene name is fra-PA
CE26976(Caenorhabditis elegans)H19M22.2a let-805
MUSCLE (v3.8.31) multiple sequence alignment
  
  
  CE26976/1-4280                 -------MGLRSRGLLLLSLGICYLQLFTLANVALNSN------------------VRVK
  TMP09698/1-1414                ------------------MDDFVLLLCVVLLAVAVPLG----------------------
  SRP08301/1-1589                ------MKIFASIFLLIYHIGLFYICTLIFLSNATNIPQYHSIRHIT---------NKRE
  PP54034/1-1392                 --------------------IFLLFLLTVQCEQR----------------------KRHH
  OVP04334/1-1751                ------------MMHHITACALILYVFIIVLSKSVHCGDPDSVSNLSTVDNQGEFYRIIR
  BM45234/1-1465                 -------------MDIIPSFALILYVFIIVLSKSAHCGSADSVKNSSIVGDQKS--RIFR
  CN16484/1-1420                 --------------MKLRHFGCILIIITSYVSSTNATT------------------RKHH
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 --------------MILRHFGFILIILTVYLSSTHATT------------------RKHH
  RP26668/1-1432                 MNSNMHKTFFTPLGIFIKISGYILLIIAVYLSSTNANT------------------RKHH
  CBP38503/1-1487                --------------MNLQHFGYILIILTVYLSTTLATT------------------RKHH
  FLYBASE:CG8581/1-1526          -MAITTNRSSRTLWNWLLSSCLIFQLIGSSLASQA-------------------------
  ENSEMBL:ENSP00000389140/1-1447 -------MENSLRCVWVPKLAFVLFGASLFSAHLQVTG--------------------FQ
  SW:P70211/1-1447               -------MENSLGCVWVPKLAFVLFGASLLSAHLQVTG--------------------FQ
                                                                                             
  
  
  CE26976/1-4280                 RQSGTDSLLTVEWEGIQTGDHA--------------------DSEVKGFLVEYRPERSGE
  TMP09698/1-1414                LNSVPN------------------------------------------IRFIVEPAD---
  SRP08301/1-1589                VRSTLN------------------------------------DDRQLNFRFLRQPES---
  PP54034/1-1392                 RRSISY------------------------------------DDRWFGFHFDNEPIS---
  OVP04334/1-1751                ERSVHDNELVKSKNNVMLYHGTIKVYLTYVKHLANLLRLFMLDDRFLGFHFTEEPTN---
  BM45234/1-1465                 KRSLPDN-----------------------------------GDRFLGFHFTEEPTN---
  CN16484/1-1420                 RRSFEN------------------------------------DSRAIGFQFVVEPKQD--
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 RRSIDN------------------------------------DARNLGFQFVMEPRRN--
  RP26668/1-1432                 RRSTEN------------------------------------DPRSIGFQFEIEPQRN--
  CBP38503/1-1487                RRSTEN------------------------------------DPRSLGFQFEVEPRRN--
  FLYBASE:CG8581/1-1526          ------------------------------------------------LSFTLEPQD---
  ENSEMBL:ENSP00000389140/1-1447 IKAFTA------------------------------------------LRFLSEPSD---
  SW:P70211/1-1447               IKPFTS------------------------------------------LHFVSEPSD---
                                                                                             
  
  
  CE26976/1-4280                 WQLHPGIIPYKGPNHQYRVQIPKLPTGISYLVRIKVIGENNEVLVETPEIRAHNEIVSIK
  TMP09698/1-1414                ----------------------------------LVVPKGQEARFDCAVAGANDESV---
  SRP08301/1-1589                ----------------------------------QIVKSNNSVILNCEFEVDKKDKL---
  PP54034/1-1392                 -----------------------------------STFHGKRTLIPCTYSLVRKRES---
  OVP04334/1-1751                -----------------------------------TVAKAGRVELNCRYAISMKNIA---
  BM45234/1-1465                 -----------------------------------TVAKAGRIELNCRYAISMRNTS---
  CN16484/1-1420                 ----------------------------------LNVVESSSYLLDCSYLLAHEKIV---
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ----------------------------------VTVMESSSHLLECSYVLAHERLV---
  RP26668/1-1432                 ----------------------------------VAVAESSSHLLECSYVLAHERFV---
  CBP38503/1-1487                ----------------------------------VTVSESTSHLLECSYVLAHERYV---
  FLYBASE:CG8581/1-1526          ----------------------------------AVVPEGHSVLLQCAGTASIGRGGKSK
  ENSEMBL:ENSP00000389140/1-1447 ----------------------------------AVTMRGGNVLLDCSAESDRGVPV---
  SW:P70211/1-1447               ----------------------------------AVTMRGGNVLLNCSAESDRGVPV---
                                                                                             
  
  
  CE26976/1-4280                 CENDDLTAPRYPQVTEVAQYSLAIKWDAPDCGSVGDYQVELTGVSAPFDIHRQTVTQPHV
  TMP09698/1-1414                ----D-------------------------------------------------------
  SRP08301/1-1589                ----D-------------------------------------------------------
  PP54034/1-1392                 ----V-------------------------------------------------------
  OVP04334/1-1751                ----S-------------------------------------------------------
  BM45234/1-1465                 ----S-------------------------------------------------------
  CN16484/1-1420                 ----Q-------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ----H-------------------------------------------------------
  RP26668/1-1432                 ----Q-------------------------------------------------------
  CBP38503/1-1487                ----Q-------------------------------------------------------
  FLYBASE:CG8581/1-1526          SNLPS-------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 SVTNLLPGTFYSVKVRAADRSRNVGPWNSEVLEAKTKGDALPISNNIQLLYRTDSELRVS
  TMP09698/1-1414                ----------------------------------------------------------VQ
  SRP08301/1-1589                --------------------------------------------------------IKIE
  PP54034/1-1392                 ----------------------------------------------------------VE
  OVP04334/1-1751                ---------------------------------------------------------RIE
  BM45234/1-1465                 ---------------------------------------------------------RTE
  CN16484/1-1420                 -------------------------------------------------------NVRVE
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 -------------------------------------------------------DVRIE
  RP26668/1-1432                 -------------------------------------------------------TVKVE
  CBP38503/1-1487                -------------------------------------------------------TVRVE
  FLYBASE:CG8581/1-1526          -------------------------------------------------------SVSIR
  ENSEMBL:ENSP00000389140/1-1447 ----------------------------------------------------------IK
  SW:P70211/1-1447               ----------------------------------------------------------IK
                                                                                             
  
  
  CE26976/1-4280                 WQPFTDPRLQHYEVTAVEVDDDSRRVERRRVDPALNSFALTGLRPNTKYTIGVIAFVDHE
  TMP09698/1-1414                WR--------------------------------LNGITLDR---RMRTYV---------
  SRP08301/1-1589                WR--------------------------------KDSLIVNSLRSTGRILV---------
  PP54034/1-1392                 WR--------------------------------RDSTPINV--SDKRISI---------
  OVP04334/1-1751                WR--------------------------------KDGAELGSLRSTGKVFV---------
  BM45234/1-1465                 WR--------------------------------KDGAELASLRPTGKMFV---------
  CN16484/1-1420                 WK--------------------------------RDGVTISE-RSSSRIRI---------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 WK--------------------------------RDGVLLSE-RTSSRIKV---------
  RP26668/1-1432                 WK--------------------------------RDGVVLNE-RSSSRIKV---------
  CBP38503/1-1487                WK--------------------------------RDGVMLSE-RSSSRIKV---------
  FLYBASE:CG8581/1-1526          WR-------------------------------GPDGQDLVIVGDTFRTQ----------
  ENSEMBL:ENSP00000389140/1-1447 WK--------------------------------KDGIHLAL-GMDERKQQ---------
  SW:P70211/1-1447               WK--------------------------------KDGLILAL-GMDDRKQQ---------
                                                                                             
  
  
  CE26976/1-4280                 PKQVYQIEAYTTSGGIESWEEKPQVVDQGKQQFAVHWKLPTTSITVSKFILEYRLPNETT
  TMP09698/1-1414                ------------------------------------------------------LPNSSL
  SRP08301/1-1589                ------------------------------------------------------LANNSI
  PP54034/1-1392                 ------------------------------------------------------LGNGSL
  OVP04334/1-1751                ------------------------------------------------------ASSGSL
  BM45234/1-1465                 ------------------------------------------------------TSSGSL
  CN16484/1-1420                 ------------------------------------------------------MSNSSL
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------MSNGSL
  RP26668/1-1432                 ------------------------------------------------------MSNGSL
  CBP38503/1-1487                ------------------------------------------------------MSNGSL
  FLYBASE:CG8581/1-1526          ------------------------------------------------------LKNGSL
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------LSNGSL
  SW:P70211/1-1447               ------------------------------------------------------LPNGSL
                                                                                             
  
  
  CE26976/1-4280                 WRTSEQKGVADESGDYSVALSQMNAPYYTVRIVAIDDQNKVVARTEELTVGEAAETSCIG
  TMP09698/1-1414                V-----------------------------------------------------------
  SRP08301/1-1589                L-----------------------------------------------------------
  PP54034/1-1392                 S-----------------------------------------------------------
  OVP04334/1-1751                I-----------------------------------------------------------
  BM45234/1-1465                 I-----------------------------------------------------------
  CN16484/1-1420                 W-----------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 W-----------------------------------------------------------
  RP26668/1-1432                 W-----------------------------------------------------------
  CBP38503/1-1487                W-----------------------------------------------------------
  FLYBASE:CG8581/1-1526          Y-----------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 L-----------------------------------------------------------
  SW:P70211/1-1447               L-----------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 SAGVPTNIRSADVDGQSIKLEWDVPRCDETHTPIDGYEYIVYEASQSAPVDGASYVGAPH
  TMP09698/1-1414                ---------------------------------VPRTASTLLSSQLSAKTDADYYQCVVT
  SRP08301/1-1589                ---------------------------------IEGAIL----------EDEGSYQCVVH
  PP54034/1-1392                 ---------------------------------LNDASR----------SDEGVYQCAVH
  OVP04334/1-1751                ---------------------------------IENVGS----------PDEGLYQCAVH
  BM45234/1-1465                 ---------------------------------IENVGS----------SDEGLYQCVVH
  CN16484/1-1420                 ---------------------------------IESMSS----------TEEGAYQCAVH
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ---------------------------------IESVSS----------AEEGTYQCAVH
  RP26668/1-1432                 ---------------------------------IESMSS----------AEEGTYQCAVH
  CBP38503/1-1487                ---------------------------------IEAMSS----------AEEGTYQCAVH
  FLYBASE:CG8581/1-1526          ---------------------------------ISSVEE--------NRGLTGAYQCLLT
  ENSEMBL:ENSP00000389140/1-1447 ---------------------------------IQNILH-----SRHHKPDEGLYQCEAS
  SW:P70211/1-1447               ---------------------------------IQNILH-----SRHHKPDEGLYQCEAS
                                                                                             
  
  
  CE26976/1-4280                 VIIKGLKQNVDYTFKVRSRSVNGHSQWSKDVIIETAVAGSVRSGELGEPNQLLRVKRQAK
  TMP09698/1-1414                VNNQ-------WVYISRKAKL-RYDVAPR-----------------------FKEEPSSR
  SRP08301/1-1589                VTDEHSNL---WSFISKKGNIFLLQTIIK-----------------------FASQPKSQ
  PP54034/1-1392                 ITDDDGST---WTFLSNKAVM-RVKNTLR-----------------------WKEEPKDT
  OVP04334/1-1751                VTDKNNFV---WTYLSRRATV-RLPFLSR-----------------------FEIQPEDR
  BM45234/1-1465                 VTDKKSFV---WTYLSRRAAV-RLPSLSR-----------------------FEIQPEDR
  CN16484/1-1420                 VTTKGNSIDDTWIFLSKKATV-RVADLAK-----------------------FDLQPTDR
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 VTTKSDQTSDTWTFLSRKATL-RLADLAK-----------------------FELQAIDR
  RP26668/1-1432                 VSTKNELTISTWTFLSRKATL-RLADLAK-----------------------FDLQPVDR
  CBP38503/1-1487                VTSKNDLAIDTWTFLSRKATL-RLADLSK-----------------------FELQPVDR
  FLYBASE:CG8581/1-1526          AEGVGSIL-------SRPALV-AIVRQPD-----------------------LNQDFLET
  ENSEMBL:ENSP00000389140/1-1447 LGDSGSII-------SRTAKV-AVAGPLR-----------------------FLSQTESV
  SW:P70211/1-1447               LADSGSII-------SRTAKV-TVAGPLR-----------------------FLSQTESI
                                                                                             
  
  
  CE26976/1-4280                 HLIKDSLNIFKLRIVLS--PP--CSFLVWTPLTQHSQIISKFKLMYKEVSSSKWIKLIGG
  TMP09698/1-1414                HVAEGSTVILLCKVHGD--SAT-PIKVRW-------------------------------
  SRP08301/1-1589                TVFEGNSAVFECQLRPS--EILFHPSVSW-------------------------------
  PP54034/1-1392                 TIQEGKRGILRCELDEK--N---KSTIRW-------------------------------
  OVP04334/1-1751                EVHVGQSVAFACKLDSQ--P---SAHIEW-------------------------------
  BM45234/1-1465                 EVHVGQSVAFACILDSQ--P---SAHIEW-------------------------------
  CN16484/1-1420                 TVTKGQPTAFHCLINSK--R---TPSAVW-------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 TLAKGQPTAFHCLINSK--P---TPTAVW-------------------------------
  RP26668/1-1432                 TIAKGQPTAFHCLINSK--P---TPLAVW-------------------------------
  CBP38503/1-1487                TVAKGQPTAFHCLINSK--P---TPSAVW-------------------------------
  FLYBASE:CG8581/1-1526          YLLPGQTAYFRCMLGEANWQEGVKHSVQW-------------------------------
  ENSEMBL:ENSP00000389140/1-1447 TAFMGDTVLLKCEVIGE--P---MPTIHW-------------------------------
  SW:P70211/1-1447               TAFMGDTVLLKCEVIGE--P---MPTIHW-------------------------------
                                                                                             
  
  
  CE26976/1-4280                 MDHFRCPPGIADPEDYCYQLKGLFFGVHYISSISYKLTNGEELPS-SNPLHFTLVQLDGS
  TMP09698/1-1414                ------------------------------------FKDGALLSD-MPA-RVTASAEGGF
  SRP08301/1-1589                ------------------------------------YYNGKVIEV-TNN-DYKIVPETNT
  PP54034/1-1392                 ------------------------------------IKDGKEITE-SNH--LLKNGYTGS
  OVP04334/1-1751                ------------------------------------FFNGKRIND-RDDSSITIFPITST
  BM45234/1-1465                 ------------------------------------FFNGKRISG-RDDSSLTIFPVTST
  CN16484/1-1420                 ------------------------------------LHNDQQITN-GGE--YHILPLSNT
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------LHNDEPIVN-GGE--YHILPVSNT
  RP26668/1-1432                 ------------------------------------LHNDQPITN-GGE--YHILPVSNT
  CBP38503/1-1487                ------------------------------------LHNDQPIVN-GGE--YHILPVSNT
  FLYBASE:CG8581/1-1526          ------------------------------------LKDDLPLP--LDKLRMVVLP-NGA
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------QKNQQDLTPIPGDSRVVVLP-SGA
  SW:P70211/1-1447               ------------------------------------QKNQQDLNPLPGDSRVVVLP-SGA
                                                                                             
  
  
  CE26976/1-4280                 AAPSNERVTLTQPRIEQSASRSVAYWSVVGDRAAVTEYQVDIRSTDERSWRAVEPSVQN-
  TMP09698/1-1414                LEIRS------------------------------------VQSSDDGVYNCKVDFDDEP
  SRP08301/1-1589                LEIQS------------------------------------VKKTHQGSYYCIISYDGF-
  PP54034/1-1392                 MEIRG------------------------------------MRKEDEGVYSCIATRDNE-
  OVP04334/1-1751                LEIIS------------------------------------VLPKHGGAYRCVATNEGK-
  BM45234/1-1465                 LEISS------------------------------------VLPKHEGAYRCVATNEGK-
  CN16484/1-1420                 LEISS------------------------------------TQPRHEGTYRCTVEGAGK-
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 LEISS------------------------------------TQSRHEGTYRCTVEGAGK-
  RP26668/1-1432                 LEISS------------------------------------TQSRHEGTYRCTVEGAGK-
  CBP38503/1-1487                LEISS------------------------------------VQSRHEGTYRCTVEGAGK-
  FLYBASE:CG8581/1-1526          LEIDE------------------------------------VGPSDRGSYQCNVTSGSS-
  ENSEMBL:ENSP00000389140/1-1447 LQISR------------------------------------LQPGDIGIYRCSARNPAS-
  SW:P70211/1-1447               LQISR------------------------------------LQPGDSGVYRCSARNPAS-
                                                                                             
  
  
  CE26976/1-4280                 EQSQTHYRLPLGQLNVASTYLVR-VRALDSSRATVATSPSASFSVLCQVPSAPENVRLER
  TMP09698/1-1414                SLTSRQGRIAV-----TAKSDDE-LKFEVKPKNQK-VNVGDSAFLLCSINGRR-------
  SRP08301/1-1589                EKKSEIGILTSKED-TSSKNDNE-LSMSLSPPSEIDVILGEKFVLPCLSSKPS-------
  PP54034/1-1392                 RIESARARISM----KKGNEPID-LHFLSRPISRR-MKEGEETLLECIPSGEG-------
  OVP04334/1-1751                TRSSRDAQLTIKPENSVGNEFSE-PYFVLEPRGDV-INEGGSVVLECLVNGWP-------
  BM45234/1-1465                 TRASRDAQLTIKPENSVGNEFSE-PNFILEPRGDV-VNEGGSVVLECLVNGWP-------
  CN16484/1-1420                 RRSSQTARLTV----STGDVSNE-LSFITTPRLQV-VDQGDEFLLECLVASRI-------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 RRSSQTARLTV----TTETVSNE-LVFITTPRLQV-VEQGDEFLLECLVASLI-------
  RP26668/1-1432                 RRSSQTARLTV----TTGDTSNE-LSFITTPRLQV-VENGDEFLLECLVASRI-------
  CBP38503/1-1487                RRSSQTARLAV----TIGEVSNE-LSFITTPRLQV-VEQGGEFLLECLVASRI-------
  FLYBASE:CG8581/1-1526          SRLSSKTNLNIKKPSDPGAENSVAPSFLVGPSPKT-VREGDTVTLDCVANGVP-------
  ENSEMBL:ENSP00000389140/1-1447 SRTGNEAEVRI----LSDPGLHRQLYFLQRPSNVV-AIEGKDAVLECCVSGYP-------
  SW:P70211/1-1447               IRTGNEAEVRI----LSDPGLHRQLYFLQRPSNVI-AIEGKDAVLECCVSGYP-------
                                                                                             
  
  
  CE26976/1-4280                 VSEQLVRAAWDSSQESGDCQSYFFITGQQNGQAINQRVPGSDRSVDIAGSSQGDWRVQVR
  TMP09698/1-1414                -------------------------------------------------------KPRVV
  SRP08301/1-1589                -------------------------------------------------------TTIVK
  PP54034/1-1392                 -------------------------------------------------------ELRVE
  OVP04334/1-1751                -------------------------------------------------------RPDVR
  BM45234/1-1465                 -------------------------------------------------------RPNVR
  CN16484/1-1420                 -------------------------------------------------------RPQIR
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 -------------------------------------------------------RPQVR
  RP26668/1-1432                 -------------------------------------------------------RPQVR
  CBP38503/1-1487                -------------------------------------------------------RPQVR
  FLYBASE:CG8581/1-1526          -------------------------------------------------------KPQIK
  ENSEMBL:ENSP00000389140/1-1447 -------------------------------------------------------PPSFT
  SW:P70211/1-1447               -------------------------------------------------------PPSFT
                                                                                             
  
  
  CE26976/1-4280                 GVNTAGSGTPSRDAIFASSAQQSRRSKRSVCDPRTDFWCKGEFSNSPLREPDSGEALCST
  TMP09698/1-1414                -------------------------------------WLKGV---AEVKYT---SRV---
  SRP08301/1-1589                -------------------------------------WINGSSSNNNIILQ--NNRI---
  PP54034/1-1392                 -------------------------------------WTKDG---RKID-D--LKGI---
  OVP04334/1-1751                -------------------------------------WLKGA---ETISIT--GDRM---
  BM45234/1-1465                 -------------------------------------WLKGA---ETISLT--GDRM---
  CN16484/1-1420                 -------------------------------------WLKDS---RQIIVD--GTRI---
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 -------------------------------------WLKDS---RQIIVD--GVRI---
  RP26668/1-1432                 -------------------------------------WLKDS---RQIIVD--GVRI---
  CBP38503/1-1487                -------------------------------------WLKDS---RQIIVD--GVRI---
  FLYBASE:CG8581/1-1526          -------------------------------------WLRNG---MDLDFNDLDSRF---
  ENSEMBL:ENSP00000389140/1-1447 -------------------------------------WLRGE---EVIQLR--SKKY---
  SW:P70211/1-1447               -------------------------------------WLRGE---EVIQLR--SKKY---
                                                                                             
  
  
  CE26976/1-4280                 PRVLAQENDLIVKWKSEGDGRGVYGYHVQFRNENSGWKTYGQLVPYVRDNMEYTQTLTGL
  TMP09698/1-1414                -RLIGESNLLIADVKPDDHG----------------------------------------
  SRP08301/1-1589                -KQVGHSSLLIEKAEIFDNG----------------------------------------
  PP54034/1-1392                 -QRMG-SSLYISSLQFDHSG----------------------------------------
  OVP04334/1-1751                -RQLGSSSFMILNAKAQDTG----------------------------------------
  BM45234/1-1465                 -RQLGSSSFMILKAKAVDTG----------------------------------------
  CN16484/1-1420                 -RRIGVSSILVSRASIEDTG----------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 -RRVGVSSILVSRASIEDTG----------------------------------------
  RP26668/1-1432                 -RRVGVSSIVVSRASIEDTG----------------------------------------
  CBP38503/1-1487                -RRVGVSSILVSRSSIEDTG----------------------------------------
  FLYBASE:CG8581/1-1526          -SIVGTGSLQISSAEDIDSG----------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 -SLLGGSNLLISNVTDDDSG----------------------------------------
  SW:P70211/1-1447               -SLLGGSNLLISNVTDDDSG----------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 ERGHAYFIHVQVLDRNSYVMYTSAQSSAKSSCSPPTHTPSHLQVAAPDASHVRVQWALPP
  TMP09698/1-1414                -------------------TYTCKVSVADRAERSSA----LLEVLVPP------EFSSSP
  SRP08301/1-1589                -------------------IYTCQVTSSKDVIEKST----RVNVRRKP------EIIKPL
  PP54034/1-1392                 -------------------MYTCRVNDSTDSIEASA----TLTLIAPP------HITSRP
  OVP04334/1-1751                -------------------VYTCRA--------------------IAP------EIISEP
  BM45234/1-1465                 -------------------VYTCRASNSQESLDASA----TVQVKVAP------KIISEP
  CN16484/1-1420                 -------------------LYTCRASNNDDSVDRAV----AVEVRAPP------KITTRP
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 -------------------LYTCRASNNDDSIDRAV----SVEVRAPP------RITTRP
  RP26668/1-1432                 -------------------LYTCRASNNDDSIDRAV----SVEVRAPP------RITTKP
  CBP38503/1-1487                -------------------LYTCRASNNDDSIDRAV----SVEVRAPP------RITTRP
  FLYBASE:CG8581/1-1526          -------------------NYQCRASNTVDSLDAQA----TVQVQEPP------KFIKAP
  ENSEMBL:ENSP00000389140/1-1447 -------------------MYTCVVTYKNENISASA----ELTVLVPP------WFLNHP
  SW:P70211/1-1447               -------------------TYTCVVTYKNENISASA----ELTVLVPP------WFLNHP
                                                                                             
  
  
  CE26976/1-4280                 QSTWGCSDIQFEIQPEEPRGQPAVVLGSHQTSHIFNSAPNQMWSVKIRAINSAGHSAWTP
  TMP09698/1-1414                ESAVGLAGKDVTFRC-EAKGYP---------------SPSVTW-----------------
  SRP08301/1-1589                HNQIAQETKDIEINC-AVESFP---------------KSKITW-----------------
  PP54034/1-1392                 QDIVAVETTDVEMEC-YSSGRP---------------PPILSW-----------------
  OVP04334/1-1751                NSVVAQETMDVEFNC-EASGEP---------------GPTISW-----------------
  BM45234/1-1465                 NNVVAQETMDVEFNC-EASGEP---------------GPSISW-----------------
  CN16484/1-1420                 ATKVAVETADVEFECGTASARP---------------EARVNW-----------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 TTKVAVETADVELECGTAAARP---------------EARVNW-----------------
  RP26668/1-1432                 VTKVAVETADVELECGTASARP---------------EARVNW-----------------
  CBP38503/1-1487                ATKVAVETADVELECGTAAARP---------------EARVSW-----------------
  FLYBASE:CG8581/1-1526          KDTTAHEKDEPELKC-DIWGKP---------------KPVIRW-----------------
  ENSEMBL:ENSP00000389140/1-1447 SNLYAYESMDIEFEC-TVSGKP---------------VPTVNW-----------------
  SW:P70211/1-1447               SNLYAYESMDIEFEC-AVSGKP---------------VPTVNW-----------------
                                                                                             
  
  
  CE26976/1-4280                 AAQTKTPPGGELIIGPDVSYRQGKPIISWRSKENTNDLIESF-VLEWKSTTESSWRQHRN
  TMP09698/1-1414                -------------------YKNGEVIKS----------SEYF-MIN--------------
  SRP08301/1-1589                -------------------YKNGEPIIP----------SEYFVVIN--------------
  PP54034/1-1392                 -------------------FKNGEMLVP----------SEYF-VIE--------------
  OVP04334/1-1751                -------------------YKNGETIIA----------SEYF-MIE--------------
  BM45234/1-1465                 -------------------YKNGEAIIA----------SEYF-VIE--------------
  CN16484/1-1420                 -------------------YKNGEAIIG----------SEYF-VIE--------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 -------------------YKNGEAIIG----------SEYF-VIE--------------
  RP26668/1-1432                 -------------------YKNGEAIIG----------SEYF-VIE--------------
  CBP38503/1-1487                -------------------YKNGEAIIG----------SEYF-VIE--------------
  FLYBASE:CG8581/1-1526          -------------------LKNGDLITP----------NDYMQLVD--------------
  ENSEMBL:ENSP00000389140/1-1447 -------------------MKNGDVVIP----------SDYFQIVG--------------
  SW:P70211/1-1447               -------------------MKNGDVVIP----------SDYFQIVG--------------
                                                                                             
  
  
  CE26976/1-4280                 PIPYNGWQRPYSVDLGELPQGHTYQVRIVAKDPNRGNAYTSPVVQVQTQSQCKAPRRAPA
  TMP09698/1-1414                ----------------------ETHLKISGLVKNDQGVY-----------QC--------
  SRP08301/1-1589                ----------------------YNNLKVLGLVKDDQGVY-----------QC--------
  PP54034/1-1392                 ----------------------SNKLRILGVVKTDQGIY-----------EC--------
  OVP04334/1-1751                ----------------------ATRLRVLGLVRNDQGVY-----------QC--------
  BM45234/1-1465                 ----------------------ATRLRVLGLVRNDQGVY-----------QC--------
  CN16484/1-1420                 ----------------------PNRLRILGVVRADQAVY-----------QC--------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ----------------------PNRLRILGVVRADQAIY-----------QC--------
  RP26668/1-1432                 ----------------------PNRLRILGVVRADQAIY-----------QC--------
  CBP38503/1-1487                ----------------------PSRLRILGVVRADQAIY-----------QC--------
  FLYBASE:CG8581/1-1526          ----------------------GHNLKILGLLNSDAGMF-----------QC--------
  ENSEMBL:ENSP00000389140/1-1447 ----------------------GSNLRILGVVKSDEGFY-----------QC--------
  SW:P70211/1-1447               ----------------------GSNLRILGVVKSDEGFY-----------QC--------
                                                                                             
  
  
  CE26976/1-4280                 DVQVSPLGPTQIRVQWAP------------------------------------------
  TMP09698/1-1414                -LAESEAGSAQASAILSV------------------------------------------
  SRP08301/1-1589                -LAENDIGSVESHSQIMI------------------------------------------
  PP54034/1-1392                 -FVENEGGTAHAAAQLLV------------------------------------------
  OVP04334/1-1751                -IAENDAGSVQSNAQLIV------------------------------------------
  BM45234/1-1465                 -IAENDAGSVQSNAQLIV------------------------------------------
  CN16484/1-1420                 -LAENDVGSEQANAQLLV------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 -IAENDVGSEQASAQLLV------------------------------------------
  RP26668/1-1432                 -IAENDVGSEQASAQLLV------------------------------------------
  CBP38503/1-1487                -IAENDVGSEQASAQLLV------------------------------------------
  FLYBASE:CG8581/1-1526          -VGTNAAGSVHAAARLRVVPQGVKIKKRKSQGHSTKSLQTFDNLTKRRKPFNSGEQLRTK
  ENSEMBL:ENSP00000389140/1-1447 -VAENEAGNAQTSAQLIV------------------------------------------
  SW:P70211/1-1447               -VAENEAGNAQSSAQLIV------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 ------------LHESEWNCDRLWYIVKHSTPQNQGFKNLTNGENFVVFDSDPYTQWNFE
  TMP09698/1-1414                -----------------------------EAS----------------------------
  SRP08301/1-1589                -----------------------------DTP----------------------------
  PP54034/1-1392                 -----------------------------DNT----------------------------
  OVP04334/1-1751                -----------------------------DSSEELLQLYALKFYSMNETTSVLEEMLNFN
  BM45234/1-1465                 -----------------------------DSS----------------------------
  CN16484/1-1420                 -----------------------------DAP----------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 -----------------------------DAP----------------------------
  RP26668/1-1432                 -----------------------------DAP----------------------------
  CBP38503/1-1487                -----------------------------DAP----------------------------
  FLYBASE:CG8581/1-1526          SGGSFPFPDEDDDLDDNDSGTTRLRIPSGKLPKFEQPLNDRRFNILNAGSALPLDNQSKS
  ENSEMBL:ENSP00000389140/1-1447 -----------------------------PKP----------------------------
  SW:P70211/1-1447               -----------------------------PKP----------------------------
                                                                                             
  
  
  CE26976/1-4280                 VQAA-----------------------------------------------NPAGESQWS
  TMP09698/1-1414                --ES-------------------------------------------------------P
  SRP08301/1-1589                -ASL-------------------------------------------------------L
  PP54034/1-1392                 --DS-------------------------------------------------------S
  OVP04334/1-1751                NTDS-------------------------------------------------------F
  BM45234/1-1465                 --DS-------------------------------------------------------F
  CN16484/1-1420                 --DS-------------------------------------------------------S
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 --DS-------------------------------------------------------S
  RP26668/1-1432                 --DS-------------------------------------------------------S
  CBP38503/1-1487                --DS-------------------------------------------------------S
  FLYBASE:CG8581/1-1526          YEDDDDDYDEDDPAKEALLEAYKQGEDAHKILDSWQQSKSKKSQQQKQSPASPDSPEQDP
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 RAQSAQTQGV-------APGAVANLRVQPIGPDSLQCSWQPPVNPNGRITQYEVTYQLIS
  TMP09698/1-1414                TKLL---VPV-------GSKEPTGLQAVHVSSRYVLLRWNGPTGWNQTLTGYGVFYK---
  SRP08301/1-1589                ALAASSGHPK-------KPGKPSGLKSVNIGSRFIELTWDLPTGNNKDIVRYHIMYK---
  PP54034/1-1392                 LIAAHSGTPV-------KVSAPLGLGVTVIGSREATLIWDPPIQKNGNILHYHLYYK---
  OVP04334/1-1751                SMAASSGQPK-------LPSEPLGVRANVVGSRFVVLTWDPPVQRHGAVLAYHIFYK---
  BM45234/1-1465                 SMAASSGQPK-------LPSEPLGVRASVVGSRFVVLTWDPPVQRHGAVLAYHIFYK---
  CN16484/1-1420                 SVAASSGVPM-------TASAPLGLRSTSSGSRFITVEWDPPVLRNGNIMRYHVFYK---
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 SVAASSGVPM-------TSSAPLGLRSTSSGSRFINVEWDPPVQRNGNIMRYHIFYK---
  RP26668/1-1432                 SVAASSGVPM-------TASAPLGLRSTSSGSRFINVEWDPPVQRNGNIMRYHVFYK---
  CBP38503/1-1487                SVAASSGVPM-------TASAPLGLRSTSSGSRFINVEWDPPVQRNGNIMRYHVFYK---
  FLYBASE:CG8581/1-1526          SVPHPGGKPLDSGLQARLPSQPRDLVAQIVKSRFVTLSWVEPLQNAGDVVYYTVYYK---
  ENSEMBL:ENSP00000389140/1-1447 AIPSSSV----------LPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFS---
  SW:P70211/1-1447               AIPSSSI----------LPSAPRDVLPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFS---
                                                                                             
  
  
  CE26976/1-4280                 RGNCDNNQE----------------APRTITVNGPH---FTITGLHPHSKYRVGVAAKSN
  TMP09698/1-1414                ----SLDAQ----------------REQQLNCTPPENQGYTVSGLLPKKTYYFRVVPISS
  SRP08301/1-1589                ----EVGQN----------------RERTLNTSLTN---IVVNGLSAEATYTFTVSAENY
  PP54034/1-1392                 ----EEGSD----------------RERVVNSTDRV---GRLRDLHPSTSYLIRVAAENE
  OVP04334/1-1751                ----EQDSS----------------RERMLNSSATS---FTVTPLQPNTTYVFRLVAENE
  BM45234/1-1465                 ----EQDSL----------------RERMLNSTAAS---FTVTPLQPNTTYVFRLAAENE
  CN16484/1-1420                 ----DNMID----------------RERMVNSSSPS---VTLTSLQPSTMYLIRVTAENE
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ----DNLID----------------RERMINSSSTS---ATLTSLQPSTMYLIRVTAENE
  RP26668/1-1432                 ----DNLIDRYYNTSLKVLYIYICFRERMINSSSTS---ATLTSLQPSTMYLIRVTAENE
  CBP38503/1-1487                ----DNSID----------------RERMINSSSTS---ATLTSLQPFTMYLIRVTAENE
  FLYBASE:CG8581/1-1526          ----MNNSE----------------REQKMVTKSHDDQQVNIQSLLPGRTYQFRVEANTN
  ENSEMBL:ENSP00000389140/1-1447 ----REGDN----------------RERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNE
  SW:P70211/1-1447               ----REGDN----------------RERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNE
                                                                                             
  
  
  CE26976/1-4280                 VGAG---ERVSLEIQTDQAAPSGAPLYLRTEDIRPTDVSISWQAPPCLQTNGEITEYEYE
  TMP09698/1-1414                AGYGSSSSPITVVTAEERNNP-SAVQHLKAYALSSTSIQIEWQPPETYAREP-IKFYKIF
  SRP08301/1-1589                AGIGEASKPLVITTEKEDLVP-GKVRNLVAKASDSESIDVSWDPPLTGGGNTNVSHYNLF
  PP54034/1-1392                 AGIGDISNPITLTTKEEQEVP-GRVVNLSAIGIGSETIQVEWRKP--SNGGAIPLFYRLF
  OVP04334/1-1751                AGMGKSSTRIFVTTTEEKAVP-GKVKNLHGIALSPETVEVLWEPP--GGNGPEPVQYKLF
  BM45234/1-1465                 AGMGKSSTRILITTAEEKAVP-GKVKNLRGTALSPETVEVSWEPP--GGNGPEPVQYKLF
  CN16484/1-1420                 AGMGKFSDSLKVTTNKEQAVP-GKVAPLVATATGPETIQIRWSPP--AGGQP-ALRYKIF
  JA57681/1-866                  --MGKFSDSIKVTTNKEQAVP-GKVNALTATATGPETIDIRWSPP--SGGQP-ALRYKIF
  CE25115/1-1415                 AGMGKFSDSLKVTTNKEQAVP-GKVASLTTTATGPETIDIRWSPP--SGGQP-ALRYKIF
  RP26668/1-1432                 AGMGKFSDSLKVTTNKEQAVP-GKVTSLTATATGPETIDIRWSPP--SGGQP-ALRYKIY
  CBP38503/1-1487                AGMGKFSDSLKVTTNKEQAVP-GKVTSLVATATGPETIDIRWSPP--SGGQP-ALRYKIY
  FLYBASE:CG8581/1-1526          FGSGASSAPLEVSTQPEVNIA-GPPRNFEGYARSHKEIYVKWEEP-TVTNGE-ILKYRVY
  ENSEMBL:ENSP00000389140/1-1447 WGPGESSQPIKVATQPELQVP-GPVENLQAVSTSPTSILITWEPP-AYANGP-VQGYRLF
  SW:P70211/1-1447               WGPGESSQPIKVATQPELQVP-GPVENLHAVSTSPTSILITWEPP-AYANGP-VQGYRLF
                                    *     : :    :   . .    :         : : *  *           *.  
  
  
  CE26976/1-4280                 V------TAGDRRQTV----QKTTENIRGTRAKIENLQPQTRYNVKVRAYTARGAGPWST
  TMP09698/1-1414                YAAVGSGSQNGPEPSAGLDVEETEIQSRNTAYVLHGVKEYTKYRIRVEAVRDDGAS----
  SRP08301/1-1589                Y------SKKDED-------RETRIPMIKTFHTLHGLSKNTEYKIRVETEGKNGVG----
  PP54034/1-1392                 Y------VRSDRKLME----KETQINVPSTAYTMHGMDKYTSYDIRVEAEGEKGAG----
  OVP04334/1-1751                Y------IRKDHEPNE----KETQIVVKKTSYTLHGMEKYVEYIIRVEAEGVNGAG----
  BM45234/1-1465                 Y------IRKDHEVNE----KETQIVMKKTSYTLHGMEKYVEYIIRVEAEGVNGAG----
  CN16484/1-1420                 Y------SHDPPEKNE----KETLITTSTTHYVLHGMDKYTGYQIRIEAEGTNGSG----
  JA57681/1-866                  Y------SHDPLEKNE----KETLITTSTTHYTLHGMDKYSGYQIRIEAEGANGSG----
  CE25115/1-1415                 Y------SHDPLEKNE----KETLITTSTTHYTLHGMDKYTGYQIRIEAEGSNGSG----
  RP26668/1-1432                 Y------SHDPLEKNE----KETLITTSTTHYTLHGMDKYTGYQIRIEAEGSNGSG----
  CBP38503/1-1487                Y------SHDPLEKSE----KETLITTSTTHYTLHGMDKYTGYQIRIEAEGANGSG----
  FLYBASE:CG8581/1-1526          Y------SENDSG-------ADLYHDSTALEAVLTELRPHTDYVISVVPFNRNGMG----
  ENSEMBL:ENSP00000389140/1-1447 C------TEVSTG-------KEQNIEVDGLSYKLEGLKKFTEYSLRFLAYNRYGPG----
  SW:P70211/1-1447               C------TEVSTG-------KEQNIEVDGLSYKLEGLKKFTEYTLRFLAYNRYGPG----
                                                      .           :  :     * : . .    * .    
  
  
  CE26976/1-4280                 EVPFQTSAGQQNVQAPGFVKVLHTGADNAQLVWQSPYPNPGYVDKYKCRYAPSGTQQYQE
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 RQFPAVSPCQQRQIERQNLPQSPPGSRLHCGRIENLRPEQTYDFQVSAHVKDSGWGPYSP
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 PERTKVTESAVQVLFVKKIGGSENSLHINWDVRPDDKNRVTAFRITVVPQDGSQRSQTFN
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 VDRATYQYRIDNLRPRTTYNVTVSAATHKEMCGGTAAVMTTDAAALTALSTAPRVIAEEP
  TMP09698/1-1414                ------------------------------------------------QSSAP-------
  SRP08301/1-1589                ------------------------------------------------KSSDI-------
  PP54034/1-1392                 ------------------------------------------------LSSNT-------
  OVP04334/1-1751                ------------------------------------------------LSSEP-------
  BM45234/1-1465                 ------------------------------------------------LSSEP-------
  CN16484/1-1420                 ------------------------------------------------LSSDI-------
  JA57681/1-866                  ------------------------------------------------LTSDT-------
  CE25115/1-1415                 ------------------------------------------------LSSDT-------
  RP26668/1-1432                 ------------------------------------------------LSSDT-------
  CBP38503/1-1487                ------------------------------------------------LSSDT-------
  FLYBASE:CG8581/1-1526          ------------------------------------------------DSSAE-------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------VSTDD-------
  SW:P70211/1-1447               ------------------------------------------------VSTDD-------
                                                                                  ::         
  
  
  CE26976/1-4280                 TSITIEWESRNREAGGFIVEYRLEGGAWQQYARRIPAHPSQTTYTATVDGLPTNAVVDLR
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 VRVVSQQNEQSNPSPEVRARTKCSPPTSPPQGVRVDAPSTNEVRVSWARPAKNTWMCDQM
  TMP09698/1-1414                ----------------VYVRSFSDKPTATPAVFSVSAVTSDKAVVRWSPPPPDG------
  SRP08301/1-1589                ----------------LFVKTLSDVPSGKPYNIKVINKMADSLLVSWIGPKEDE------
  PP54034/1-1392                 ----------------VTVRTLSDLPSMAPIDITARSISTTSIKVAW-KVDESQ------
  OVP04334/1-1751                ----------------ITIRTLSDLPSLPPSDVRAEAISTTSIHVQWMPLPIED------
  BM45234/1-1465                 ----------------ITVRTLSDLPSLPPSDVRAEAISTTSILVQWMPLSAED------
  CN16484/1-1420                 ----------------VRVRTLSDEPSSPPTNIRAEADSSTSVRVSWEEPEENS------
  JA57681/1-866                  ----------------VKVRTQSDEPEAPPVSIQAEADSSTSIRVSWDQPADET------
  CE25115/1-1415                 ----------------VKVRTQSDEPSAPPVNIQAEADSSTSVRVSWDEPEEES------
  RP26668/1-1432                 ----------------VRVRTQSDEPSAPPVNIQAEADSSTSVRVSWDEPEEES------
  CBP38503/1-1487                ----------------VRIRTQSDEPSAPPVNIQAEADSSTSVRVSWDEPEKYS------
  FLYBASE:CG8581/1-1526          ----------------IRVKTFSSTPSEPPNNVTLEVTSSSSITVHWEPPAEED------
  ENSEMBL:ENSP00000389140/1-1447 ----------------ITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGT------
  SW:P70211/1-1447               ----------------ITVVTLSDVPSAPPQNISLEVVNSRSIKVSWLPPPSGT------
                                                 :   : .. *   *  .      : .  * *             
  
  
  CE26976/1-4280                 NVEISYRVGNQPEKVLTVPGDQTEYTFPAEPNQRWVVKLRATNQVGSSQWSPEQSITTRQ
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 GAPGSVRDLRVKALSPNEVHVQWLAPLVQRGTIVGYDISYRLKHRLACPEEEPRDVSRDF
  TMP09698/1-1414                ----------------------------CNGEITSYKIRYRLKDR---------------
  SRP08301/1-1589                ----------------------------KNGDITGYIIKYKAKKK---------------
  PP54034/1-1392                 ----------------------------SNGPITGARMKMKTKAR---------------
  OVP04334/1-1751                ----------------------------RNGILTGYRIKYKTKLR---------------
  BM45234/1-1465                 ----------------------------RNGILTGYRIKYKTKLR---------------
  CN16484/1-1420                 ----------------------------VNGEITGYRLKYKTKAR---------------
  JA57681/1-866                  ----------------------------VNGEITGYRLKYKTKAR---------------
  CE25115/1-1415                 ----------------------------VNGEITGYRLKYKTKAR---------------
  RP26668/1-1432                 ----------------------------VNGEITGYRLKYKTKAR---------------
  CBP38503/1-1487                ----------------------------VNGEVTGYRLKYKTKAR---------------
  FLYBASE:CG8581/1-1526          ----------------------------RNGQITGYKIRYRKFKD---------------
  ENSEMBL:ENSP00000389140/1-1447 ----------------------------QNGFITGYKIRHRKTTR---------------
  SW:P70211/1-1447               ----------------------------QNGFITGYKIRHRKTTR---------------
                                                              .* :..  :  :                   
  
  
  CE26976/1-4280                 VTVYNHKDLDYTITGLLPYSLYEVRVRARTTELGPEETKEVSTEQQPPSSPPLNLESTYA
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 LERSLSFQWEPVDCSQRHGHVVNYEYEILGQDDWAKLERQIANTSDLRVTIDGLTPYTKY
  TMP09698/1-1414                ---------------------------------GSRTYNVHVDSPKTEFTISDLEAGATY
  SRP08301/1-1589                ---------------------------------NSKLKSVFVKGNVQKFELTRLEGGTQY
  PP54034/1-1392                 ---------------------------------GSKASNIVMDSSRLEEIVEGLEAGTAY
  OVP04334/1-1751                ---------------------------------GTKGNTLVVDGNNSSYTISGLEPGTQY
  BM45234/1-1465                 ---------------------------------GAKSNTLVIDGNNSSYIISGLEPGTQY
  CN16484/1-1420                 ---------------------------------GAKGNMLVIDATAQEYTMGNLEPNTQY
  JA57681/1-866                  ---------------------------------GAKGNTLVIDATARDYTMGNLEPSTQY
  CE25115/1-1415                 ---------------------------------GAKGNTLVIDATAREYTMGNLEPNTQY
  RP26668/1-1432                 ---------------------------------GAKGNTLVIDATAREYTMGNLDSNTQY
  CBP38503/1-1487                ---------------------------------GAKGNTLVIDATSREYTMGNLEPNTQY
  FLYBASE:CG8581/1-1526          ---------------------------------APQVKS--TPANIRYFELSNLDRNAEY
  ENSEMBL:ENSP00000389140/1-1447 -----------------------------------RGEMETLEPNNLWYLFTGLEKGSQY
  SW:P70211/1-1447               -----------------------------------RGEMETLEPNNLWYLFTGLEKGSQY
                                                                    :              .  *   : *
  
  
  CE26976/1-4280                 VMRVKAYNSIGGGPNTENLVVMTAKAQAPLPPQDLVVAQEGTSFFMVSWLPPYPPYGPHD
  TMP09698/1-1414                VVRVAAVTVNGTGPFT--------------------------------------------
  SRP08301/1-1589                SIRIAAINSNGTGPYS--------------------------------------------
  PP54034/1-1392                 QLRIALVNQNGTGPYS--------------------------------------------
  OVP04334/1-1751                MLRVAAVNQNGSGPNS--------------------------------------------
  BM45234/1-1465                 MLRVAAINQNGSGPNS--------------------------------------------
  CN16484/1-1420                 LIRMAVVNHNGTGPFS--------------------------------------------
  JA57681/1-866                  LVRMAVVNHNGTGPFS--------------------------------------------
  CE25115/1-1415                 LIRMAVVNHNGTGPFS--------------------------------------------
  RP26668/1-1432                 LIRMAVVNHNGTGPFS--------------------------------------------
  CBP38503/1-1487                LIRMAVVNHNGTGPFS--------------------------------------------
  FLYBASE:CG8581/1-1526          QVKIAAMTVNGSGPFT--------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 SFQVSAMTVNGTGPPS--------------------------------------------
  SW:P70211/1-1447               SFQVSAMTVNGTGPPS--------------------------------------------
                                  .::   .  * ** :                                            
  
  
  CE26976/1-4280                 AYKIRYQQIPSDDWKEVEKGIKDPLLQCPGESPRFCYNATGLDSGQQFKIQVATRIEGGS
  TMP09698/1-1414                ------------PWKEVVMTVYE-------------------------------GEESQV
  SRP08301/1-1589                ------------EAIHAETTFEE-------------------------------RDENRI
  PP54034/1-1392                 ------------DWISVDTPLTE-------------------------------KDE-SV
  OVP04334/1-1751                ------------DWFHVDTPLED-------------------------------KDEGQV
  BM45234/1-1465                 ------------DWFHVDTPLED-------------------------------KDEGQV
  CN16484/1-1420                 ------------DWVTVDTPGQD-------------------------------KEE-RT
  JA57681/1-866                  ------------DWVAVDTPGQD-------------------------------KEE-RT
  CE25115/1-1415                 ------------DWVSIDTPGQD-------------------------------KEE-RT
  RP26668/1-1432                 ------------DWVAVDTPGQD-------------------------------KEE-RT
  CBP38503/1-1487                ------------EWVAVDTPGQD-------------------------------KEE-RT
  FLYBASE:CG8581/1-1526          ------------EWNRANTLEND-------------------------------LDETQV
  ENSEMBL:ENSP00000389140/1-1447 ------------NWYTAETPEND-------------------------------LDESQV
  SW:P70211/1-1447               ------------NWYTAETPEND-------------------------------LDESQV
                                                       :                                 *   
  
  
  CE26976/1-4280                 YGPWSSLVIANTLQVLPDAPRAIHLIEKTDHSLHIRWVPPIDP----KGYVTQYRVSIVS
  TMP09698/1-1414                PGG----------------PTSLHLQATSNE-ISLTWTPPLDDGNLIRGYLVGWGINVPD
  SRP08301/1-1589                AGA----------------PIELKVIPSHDR-IKVSWQAPKDDSVIIRGYNIGWGVNVPD
  PP54034/1-1392                 LGA----------------PRELTARATSDS-ISLRWIPPADESVLVRGYQIGWGLNVPD
  OVP04334/1-1751                AGP----------------PLSLKVQPSVDS-IQLSWLPPRDDSVMIRGYLIGWGINIPD
  BM45234/1-1465                 AGP----------------PLSLKVQPSVDS-IQLSWLPPRDDSVMIRGYLIGWGINIPD
  CN16484/1-1420                 LGA----------------PREIRPHAGIDY-ILVSWLPPADEQNIVRGYQIGWGLSVPD
  JA57681/1-866                  LGA----------------PREIRPHAGIDY-ILVSWLPPADEQNLVRGYQIGWGLSVPD
  CE25115/1-1415                 LGA----------------PREIRPHAGIDY-ILVSWLPPADEQNLVRGYQIGWGLSVPD
  RP26668/1-1432                 LGA----------------PREIRPHAGIDY-ILVSWLPPADEQNLVRGYQIGWGLSVPD
  CBP38503/1-1487                LGA----------------PREIRPHAGIDY-ILVSWLPPADEQNLVRGYQIGWGLSVPD
  FLYBASE:CG8581/1-1526          PGK----------------PIWISIHPGANN-IALHWGPPQHPEIKIRNYVLGWGRGIPD
  ENSEMBL:ENSP00000389140/1-1447 PDQ----------------PSSLHVRPQTNC-IIMSWTPPLNPNIVVRGYIIGYGVGSPY
  SW:P70211/1-1447               PDQ----------------PSSLHVRPQTNC-IIMSWTPPLNPNIVVRGYIIGYGVGSPY
                                  .                 *  :      :  : : * .* .     :.*   :  .   
  
  
  CE26976/1-4280                 LDDVNDKKRTHIVNHPTLTYLFEELNPETSYNISISAGTKQGFGREIWTRYTTDPFNIPV
  TMP09698/1-1414                IETQR-------VPGNSRTFVIRKLRPNKDYVVSLKAFNRLGNG-------------FPI
  SRP08301/1-1589                VDSVQ-------VDENTKEYTIKNLKPNKEYVISARAFNNAGNG-------------FPI
  PP54034/1-1392                 VDSSR-------VDGDIHEFKISGLKPSRDYVISVRAFNRQGSG-------------FPI
  OVP04334/1-1751                VDQVK-------VPASLRLYTINGLRPGRDYVISLRAYNLIGNG-------------FPI
  BM45234/1-1465                 VDQVK-------VPASLRLHTINGLKPGRDYVISLRAYNMIGNG-------------FPI
  CN16484/1-1420                 TETAR-------VTASTTQYKIARLNSERDYVISLRAFNNLGSG-------------FPI
  JA57681/1-866                  TETAR-------VSASTTQYKISRLHSERDYVISLRAFNNLGSG-------------FPI
  CE25115/1-1415                 TETIR-------VTASTTQYKIARLHSERDYVISLRAFNNLGSG-------------FPI
  RP26668/1-1432                 TETIR-------VTASTTQYKISRLNSERDYVISLRAFNNLGSG-------------FPI
  CBP38503/1-1487                TETIR-------VTASTTQYKISRLSSERDYVISLRAFNNLGSG-------------FPI
  FLYBASE:CG8581/1-1526          ENTIE-------LKETERYHILKNLESNMDYVVSLRARNVKGDG-------------PPI
  ENSEMBL:ENSP00000389140/1-1447 AETVR-------VDSKQRYYSIERLESSSHYVISLKAFNNAGEG-------------VPL
  SW:P70211/1-1447               AETVR-------VDSKQRYYSIERLESSSHYVISLKAFNNAGEG-------------VPL
                                  :  .       :      . :  * .   * :*  * .  * *              *:
  
  
  CE26976/1-4280                 VGTMPTVTPDGANALDVQWNAVLDPKNRVKGYIIEIRNSDTPVWQEIGGVTNHDAGKSTY
  TMP09698/1-1414                YETVRTEDKSSKDVSV--------------------------------------------
  SRP08301/1-1589                YETIRTTSYSNNVFAGFGKSNDKNKGSD--------------------------------
  PP54034/1-1392                 YETVRTSSTGASMIGG------EGIDGK--------------------------------
  OVP04334/1-1751                YETVRTLSPDSKSIAG------GQQNGK--------------------------------
  BM45234/1-1465                 YETVRTLSPESKSMAS------GQQNNK--------------------------------
  CN16484/1-1420                 YETVRTLSRESP-RFN------EDYDGE--------------------------------
  JA57681/1-866                  YETVRTLSRASMSHFS------DNDDDG--------------------------------
  CE25115/1-1415                 YETVRTLSRETPSHFN------EDSDSD--------------------------------
  RP26668/1-1432                 YETVRTLSRETP-HFS------EDSDSD--------------------------------
  CBP38503/1-1487                YETVRTLSRETP-HFS------EDSDSD--------------------------------
  FLYBASE:CG8581/1-1526          YDNIKTRDEEPVDAPT--------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 YESATTRSITDPTDPVDYYPLLDDFPTS--------------------------------
  SW:P70211/1-1447               YESATTRSITDPTDPVDYYPLLDDFPTS--------------------------------
                                   .  *                                                      
  
  
  CE26976/1-4280                 FKKLTGLDSDTLYFIRIKVVDQRQRVGVPSPEAQARTGCAAPLSPPTNLNLASPSNVQVR
  TMP09698/1-1414                -----------------------------------------SVETPIGLRAVTLSSTAIS
  SRP08301/1-1589                --------------------ETYYNDDDESFGSEGKFEATDENGVPTYVTSETLSATSIK
  PP54034/1-1392                 -------------------------------GSEIS-----VLDSPLGVHSTALSATSIR
  OVP04334/1-1751                --------------------DS---------ER--------SE-TPIGVRALTLSSSSIR
  BM45234/1-1465                 --------------------DS---------GR--------SE-TPIGVRALTLSSSSIR
  CN16484/1-1420                 --------------------DSDRS--AGGAGS--------PETTPVGLRSEATSATSIR
  JA57681/1-866                  --------------------DADMNSDDSSRGN--------SDSTPVGLRADAISATSIR
  CE25115/1-1415                 --------------------DS-----D--VGS--------SESTPVGVRAEAISATSIR
  RP26668/1-1432                 --------------------DS-----DGALGS--------SESTPVGLRTEAVSGTSIR
  CBP38503/1-1487                --------------------DA-----DGQLGS--------SESTPVGLRTEAVSGTSIR
  FLYBASE:CG8581/1-1526          -----------------------------------------PLEVPVGLRAITMSSSSIV
  ENSEMBL:ENSP00000389140/1-1447 ---------------------------VPDLST--------PMLPPVGVQAVALTHDAVR
  SW:P70211/1-1447               ---------------------------GPDVST--------PMLPPVGVQAVALTHEAVR
                                                                              *  :   : :   : 
  
  
  CE26976/1-4280                 VSWQAPN-QNSWKCS----AIRYKLEYINGTE-GRKQIDLPSSSIEHLFDS-KSNTKWTV
  TMP09698/1-1414                LLWTDRN-QGSLPPNIQSDDRYYTVRYTSHYVSGGRYRYVNTSESSYVIDGLKPDTQYEF
  SRP08301/1-1589                ISWSEEN-INVFNPE-------YSVKYFSRADPRGEVKYVKTSENEIEIEGLRPNTVYEF
  PP54034/1-1392                 LDWADN--PSLFNIV-------YNVKYMSKID-SGQARFLNTSESWIVVDKLKPGTEYEL
  OVP04334/1-1751                VTWTDAEMDIPYSRQ-------YTVRYSSSIENGGQRRYINTSEMEVVIEGLRPNTQYEF
  BM45234/1-1465                 VIWTDAELDIPYSRQ-------YTVRYSSNVENGGQRRYINTSELEVVIDGLRPNTQYEF
  CN16484/1-1420                 VIWTEPD-ETAFNIQ-------YTVRYSTAID-GNQHRYINSTETWATVEGLRPATEYEF
  JA57681/1-866                  VVWTESD-ETAFNTQ-------YTVRYSTAID-GNQHRYVNSTETWATIEGLRPATEYEF
  CE25115/1-1415                 VMWTESD-ETAFNTQ-------YTVRYSTAVD-GNQHRYVNSTETWATVEGLRPATEYEF
  RP26668/1-1432                 VMWTESD-ESAFNTQ-------YTVRYSTAVD-GNQHRYVNSTETWATVEGLRPATEYEF
  CBP38503/1-1487                VMWTESD-ESAFNTQ-------YTVRYSTSVD-GNQHRYVNSTETWATVEGLRPATEYEF
  FLYBASE:CG8581/1-1526          VYWIDTMLNKNQHVT---DNRHYTVSY--GITGSNRYRYHNTTDLNCMINDLRPNTQYEF
  ENSEMBL:ENSP00000389140/1-1447 VSWADNSVPKNQKTS---EVRLYTVRWRTSFSASAKYKSEDTTSLSYTATGLKPNTMYEF
  SW:P70211/1-1447               VSWADNSVPKNQKTS---DVRLYTVRWRTSFSASAKYKSEDTTSLSYTATGLKPNTMYEF
                                 : *                   *.: :        .     ::.        :. * : .
  
  
  CE26976/1-4280                 RIRTENDAGS-SEWSKELSITTSEGAPGPV-EGLTAKP-------TGPTSIVARWKPPRD
  TMP09698/1-1414                SVKAALGRFE-SEWSMTAFNKTYSSAPSSAPRDLTTIDSD-----SDPTSVLLNWQPPKH
  SRP08301/1-1589                SIRLIGSTK----WSAPSSNKTMPAPPSSAPQDLTIIPPSQHYRKSDPNSVTLNWQPPKY
  PP54034/1-1392                 AVRCMVPPSSLSPWSMTVSQVTLPTAPSSSPRDVTVLPAAS----GDPHSVTVNWQPPKY
  OVP04334/1-1751                AVRVNAGKSS-SMWSMTAVNSTAPAPPSSAPRDLTIMQPID----GDPQTLILNWQPPKY
  BM45234/1-1465                 AVRVNAGKSS-SMWSMTAVNSTAPAPPSSAPRDLTIMQPTD----GDPQTLILNWQPPKY
  CN16484/1-1420                 AVRAVTSNGQLSTWSMATRNRTLTAPPSSAPRDLTVLPAES----GDPHSASLHWQPPKY
  JA57681/1-866                  AVRAVASNGQLSTWSMATRNRTSSAPPSSAPRDLTVLPAES----GDPHSASLHWQPPKY
  CE25115/1-1415                 AVRAVASNGQLSTWSMATRNRTLAAPPSSAPRDLTVLPAES----GDPHSSSLHWQPPKY
  RP26668/1-1432                 AVRAVASNGQLSTWSMATRNRTWSAPPSSAPRDLTVLPAES----GDPHSASLHWQPPKY
  CBP38503/1-1487                AVRAVASNGQLSTWSMAARNRTWSAPPSSAPRDLTVLPAES----GDPHSASLHWQPPKY
  FLYBASE:CG8581/1-1526          AVKVVKGRRE-SSWSMSVLNSTYQNVPVTPPREVTVRLDE-----MNPPTVIVQWIPPKH
  ENSEMBL:ENSP00000389140/1-1447 SVMVTKNRRS-STWSMTAHATTYEAAPTSAPKDLTVITRE-----GKPRAVIVSWQPPLE
  SW:P70211/1-1447               SVMVTKNRRS-STWSMTAHATTYEAAPTSAPKDLTVITRE-----GKPRAVIVSWQPPLE
                                  :           **      *    * .  . :*            * :    * **  
  
  
  CE26976/1-4280                 PNGVITGYTLTYQLKSIGECGPRSSTPIEKHVKNEEETLEGLLPDSTYEIHVVAHTSHAG
  TMP09698/1-1414                PNGKITKYLIYYTSEPK-------------------------LTDSS-------------
  SRP08301/1-1589                ANGEILEYLIYYSNKEE-------------------------LPDKD-------------
  PP54034/1-1392                 ANGELTEYIVYYTDRGS-------------------------AREEE-------------
  OVP04334/1-1751                ANGDIEEYLVYYADRSD-------------------------APDKD-------------
  BM45234/1-1465                 ANGDIEEYLVYYADRSD-------------------------APDKD-------------
  CN16484/1-1420                 SNGEIEEYLIFYTESPT-------------------------LSDKE-------------
  JA57681/1-866                  ANGEIEEYLIFYTDRAS-------------------------LADKD-------------
  CE25115/1-1415                 SNGEIEEYLVFYTDRAS-------------------------LADKD-------------
  RP26668/1-1432                 SNGEIEEYLVFYTDRES-------------------------LADKD-------------
  CBP38503/1-1487                SNGEIEEYLVFYTDRES-------------------------LSDKD-------------
  FLYBASE:CG8581/1-1526          TLGQITGYNIYYTTDTT-------------------------KRDRD-------------
  ENSEMBL:ENSP00000389140/1-1447 ANGKITAYILFYTLDKN-------------------------IPIDD-------------
  SW:P70211/1-1447               ANGKITAYILFYTLDKN-------------------------IPIDD-------------
                                 . * :  * : *                                                
  
  
  CE26976/1-4280                 PQSSVVTVTTEEAAPTGPPQNVRAGSVTSSRADITWTQPECEQRNGKITDYEYELWSMDT
  TMP09698/1-1414                -------------------------------------------------------WMIEG
  SRP08301/1-1589                -------------------------------------------------------WLRDS
  PP54034/1-1392                 -------------------------------------------------------WISIR
  OVP04334/1-1751                -------------------------------------------------------WILDG
  BM45234/1-1465                 -------------------------------------------------------WILDG
  CN16484/1-1420                 -------------------------------------------------------WIINY
  JA57681/1-866                  -------------------------------------------------------WTINY
  CE25115/1-1415                 -------------------------------------------------------WTINY
  RP26668/1-1432                 -------------------------------------------------------WTINY
  CBP38503/1-1487                -------------------------------------------------------WTINY
  FLYBASE:CG8581/1-1526          -------------------------------------------------------WSVEA
  ENSEMBL:ENSP00000389140/1-1447 -------------------------------------------------------WIMET
  SW:P70211/1-1447               -------------------------------------------------------WIMET
                                                                                        *    
  
  
  CE26976/1-4280                 WADNSTGHNPTERLNLDQLIPYTQYQIRVRAINK----------------EGDG--PFSE
  TMP09698/1-1414                IRGDRMST------TIDGLSPEKDYFFKIQAVND----------------RGYG--PVSA
  SRP08301/1-1589                VRGDKLSL------EISNLLPFTTYHFKVQARNV----------------KGYG--PLSR
  PP54034/1-1392                 VAPDRLSV------PIDNLLPKATYYFRIQAKNE----------------KGMG--PMSP
  OVP04334/1-1751                VKGDHLSI------KLTNLLPRQTYFFKVQARNI----------------KGYG--PLSP
  BM45234/1-1465                 VKGDHLSI------KLTNLLPRQTYFFKVQARNI----------------KGYG--PLSP
  CN16484/1-1420                 VAGDKLSH------QVSNLLPKANYFFKIQARNEKGKLSNRCFHIISSYFKGHG--PFSL
  JA57681/1-866                  VGGEKLSH------QVSNLLPKANYFFKIQARNE----------------KGHG--PFSS
  CE25115/1-1415                 VAGDKLSH------QVSNLLPKANYFFKIQARNE----------------KGHG--PFSS
  RP26668/1-1432                 VAGDKLSH------QVSNLLPKANYFFKIQARNE----------------KGHG--PFSS
  CBP38503/1-1487                VAGDKLSH------QVSNLLPKANYFFKIQARNE----------------KGHG--PFSS
  FLYBASE:CG8581/1-1526          FAGEETML------MLPNLKPYTTYYFKVQARTT----------------KGANNAPFSA
  ENSEMBL:ENSP00000389140/1-1447 ISGDRLTH------QIMDLNLDTMYYFRIQARNS----------------KGVG--PLSD
  SW:P70211/1-1447               ISGDRLTH------QIMDLSLDTMYYFRIQARNV----------------KGVG--PLSD
                                    :           :  *     * ::::* .                 .* .  *.* 
  
  
  CE26976/1-4280                 WVPFTT--SATNPPAPSDLQEEATFPHAIEISWLPPTPPHGNIDFYKVRYTPSGEANYRE
  TMP09698/1-1414                VKPYRA--RRMKS-LLGPMGNVDHLPG---------------------------------
  SRP08301/1-1589                PVSYMI--SGSQSKNLGIFGNEEGS-----------------------------------
  PP54034/1-1392                 NQSYSP--GSAGFVHPT--GNSVKTKK---------------------------------
  OVP04334/1-1751                ILQFVP--GAPPPPLFQ--STDID------------------------------------
  BM45234/1-1465                 TLQFVP--GAPPPRLFQ--DVDID------------------------------------
  CN16484/1-1420                 NVGYTP--NGGA--ILS--GRDRSSSQ---------------------------------
  JA57681/1-866                  VVGYTP--SGGA--ILS--GRERT--R---------------------------------
  CE25115/1-1415                 VVGYTP--SGGA--ILS--GKDRHNAR---------------------------------
  RP26668/1-1432                 IVGYTP--SGGA--ILS--GRDRNSPR---------------------------------
  CBP38503/1-1487                IVGYTP--SGGA--ILS--GRDRNVPR---------------------------------
  FLYBASE:CG8581/1-1526          LVSYTT--SAAV--TMQ--EPDTIAKG---------------------------------
  ENSEMBL:ENSP00000389140/1-1447 PILFRTLKVEHPDKMAN--DQGRHGDG---------------------------------
  SW:P70211/1-1447               PILFRTLKVEHPDKMAN--DQGRHGDG---------------------------------
                                    :                                                        
  
  
  CE26976/1-4280                 IRVETDRLECSDSNKKDRLCYRLSDLDPEQEYDIQVSAHTEGGGWSEWSDELTSRTQQQN
  TMP09698/1-1414                -----------------------------------------VVR---------AEAMSTG
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 -----------------------------------------GA-----------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 -----------------------------------------NHG---------STSRGGA
  JA57681/1-866                  -----------------------------------------GHG---------S-TSSDQ
  CE25115/1-1415                 -----------------------------------------GHG---------SAASGDT
  RP26668/1-1432                 -----------------------------------------GHG---------SAAAGDS
  CBP38503/1-1487                -----------------------------------------GHG---------S-AMGDT
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 -----------------------------------------GYWPVDTNLIDRSTLNEPP
  SW:P70211/1-1447               -----------------------------------------GYWPVDTNLIDRSTLNEPP
                                                                                             
  
  
  CE26976/1-4280                 IPVLERELEVT---DKTSNSISLKWEGLPQDQATHVVGYVLEFKSEDDNAEWQEYNGVVK
  TMP09698/1-1414                ---SPNVDAGF---SWNALSLII------------AVVCGVVV-----------------
  SRP08301/1-1589                ---LLSPKIIS---FIRANFILI------------IIGVIVIV-----------------
  PP54034/1-1392                 ---IHDFVWSI---NDVTLWPIV------------IIVLIVLL-----------------
  OVP04334/1-1751                ---LETPHLVL---FSTPAYLVF------------MVAIFILL-----------------
  BM45234/1-1465                 ---LETPRLAL---FSTPAYLAI------------TAAIVILF-----------------
  CN16484/1-1420                 VSFVDQLQSLL---QSNPLLLML------------TAALLLIL-----------------
  JA57681/1-866                  TSLVEQFKSIL---QSNPLYLML------------LVAFALIL-----------------
  CE25115/1-1415                 VSLVDQLQSLL---HSNPLYLIL------------LAAFALIL-----------------
  RP26668/1-1432                 ISLVEQLQSIF---SSNPLYLML------------LIAFALIL-----------------
  CBP38503/1-1487                VSLIEQLQSIF---QTNPLYLML------------LIAFALIL-----------------
  FLYBASE:CG8581/1-1526          ---IDNEKLL---------YIII------------AATAVVLL-----------------
  ENSEMBL:ENSP00000389140/1-1447 IGQMHPPHGSVTPQKNSNLLVII------------VVTVGVIT-----------------
  SW:P70211/1-1447               IGQMHPPHGSVTPQKNSNLLVIT------------VVTVGVLT-----------------
                                                                         :                   
  
  
  CE26976/1-4280                 HRKTSSDYKITVKQLETATLYFFRLRVVGKNDKRGQPGPETKET------TSCGKPEAP-
  TMP09698/1-1414                ---------ILVIALA---VYVYRQR----KGRTRGYTAGVKKT---------LRDSKP-
  SRP08301/1-1589                ---------VLLLIIILCAIICSNRRNNPKSSMAHQNGALYSTVNNRRQGINDKDNRDG-
  PP54034/1-1392                 ---------ILILCLV---CVCIVKKVST-KSSPNGYGGG--------GGRKASNGMNR-
  OVP04334/1-1751                ---------IILLIAV---IWYIRSKNIK-KSTASGYMRGKKQF---------KNGKGP-
  BM45234/1-1465                 ---------MVLMITV---IWYIRSKNSK-KSTTAGYVRGRKQV---------RNGKGP-
  CN16484/1-1420                 ---------ILIVILI---VMCCVKRNNA-GGRKNGYQSAKKTS----NGGGVGGAGGP-
  JA57681/1-866                  ---------VLTLILI---IMCCVKRSGGSGGRKNGYQSGKKTS---VGGAMGGAGGGP-
  CE25115/1-1415                 ---------ILTLILI---IMCCWKRSSG-GGRKNGYQSGKKTSAGAGSGGGIGGLGGP-
  RP26668/1-1432                 ---------ILTLILI---IMCCLKRSNG-GGRKNGYQSAKKTS---ANGGV-GGIGGP-
  CBP38503/1-1487                ---------ILTLILI---IMCCLKRSGG-GGRKNGYQSAKKTS---GSGGVGGGIGGP-
  FLYBASE:CG8581/1-1526          ---------VVLLGVL---LLCRRKPQSSPEHTKKSYQK--------------NNVGVPK
  ENSEMBL:ENSP00000389140/1-1447 ---------VLVVVIV--AVICTRRSSAQQRKKRATHSAGKRK----------GSQKDLR
  SW:P70211/1-1447               ---------VLVVVIV--AVICTRRSSAQQRKKRATHSVSKRK----------GSQKDLR
                                          :                                                  
  
  
  CE26976/1-4280                 PESLKLESLDFETLKITWTP--PEESTWRC-DN-----VEYLIDFVNTTSRGNWTVSTDA
  TMP09698/1-1414                PPDL-------------WIHHEHHSVEMRGVEG-----KNSGLDGSSFC-----------
  SRP08301/1-1589                VSDL-------------WIN-----GNPNN-SS-----REVYCDTPEIT-----------
  PP54034/1-1392                 NNDL-------------WIQH-GVGG-----AS-----SHLLTETPSIN-----------
  OVP04334/1-1751                P-DL-------------WINH-HSGGHQIH-EP-----ENLIEEALAVP-----------
  BM45234/1-1465                 P-DL-------------WINH-HSGGHQIH-EP-----ENLIEEALATS-----------
  CN16484/1-1420                 PNDL-------------WIN--GVGSHMRA-GA-----SDYMVDGLATA-----------
  JA57681/1-866                  PNDL-------------WIN--GTGSHMRA-GA-----SDYMVDGLATA-----------
  CE25115/1-1415                 PNDL-------------WIN--GTGSHMRA-GA-----SDYMVDGLATA-----------
  RP26668/1-1432                 PNDL-------------WIN--GTGSHMRA-GA-----SDYMVDGLATA-----------
  CBP38503/1-1487                PNDL-------------WIN--GTGSHMRA-GA-----SDYMVDGLATA-----------
  FLYBASE:CG8581/1-1526          PPDL-------------WIH--HDQMELKNIDKGLHTVTPVCSDGASSS-----------
  ENSEMBL:ENSP00000389140/1-1447 PPDL-------------WIH--HEEMEMKN-IE-----KPSGTDPAGRD-----------
  SW:P70211/1-1447               PPDL-------------WIH--HEEMEMKN-IE-----KPTGTDPAGRD-----------
                                   .*             *                         :                
  
  
  CE26976/1-4280                 PSELIVPTQPGTKWDVKIRTQTVEDSGKPQASRWSDRVSITTQSLPGEIFVTVEPKGPRE
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 ALVTWELPDKDQKWNYGVDITYKLKQLGGCNEVQTG---AKEPVTLLNVQEKQIPLENLQ
  TMP09698/1-1414                ----------------------DLMQMKSCR--------TPTPPMPDVPRYQSL------
  SRP08301/1-1589                -------------------------LLDGQRMAKNS---ADSPP----PLYQTLQDNQKG
  PP54034/1-1392                 -------------------------DIKNGRNG------VSTP-----PRYHNGTIN-RG
  OVP04334/1-1751                -----------------------SNDLNHCGDVIQM---VDSPQ----SQYLTL------
  BM45234/1-1465                 -----------------------LNDLNHCDDVIEM---VDSPR----SQYLAV------
  CN16484/1-1420                 -------------------------HLTAAE--------MESPT----PRYHHL------
  JA57681/1-866                  -------------------------HLTAAD--------IESPT----PRYHHL------
  CE25115/1-1415                 -------------------------HLTAAD--------IESPT----PRYHHL------
  RP26668/1-1432                 -------------------------HLTAAD--------IESPT----PRYHHL------
  CBP38503/1-1487                -------------------------HLTAAD--------IDSPT----PRYHHLQDSVYG
  FLYBASE:CG8581/1-1526          ------------------------GALTLPRSVVHSEYEVETPV----PGHVTN------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------SPIQSCQDLT--------------PVSHSQSETQLG
  SW:P70211/1-1447               ------------------------SPIQSCQDLT--------------PVSHSQSETQMG
                                                           :                                 
  
  
  CE26976/1-4280                 PGSLYEVSVTPRRPPSLHSSIVTPKTVRTFRTKNDVPTGPPQNLQSTVRKDSELGFKWDA
  TMP09698/1-1414                -----------------------------------AHVQP--------------------
  SRP08301/1-1589                LNSLSPFSLCPSVDARRISTSSDISVSTNICKGRTPPMLPLRMTESLHEPKKVLVPTVPY
  PP54034/1-1392                 EDTYACVIGGRRIPSLPYDNESSIDSTRPLLSSRITHKSHPHMVQVAPPAPGSSTG----
  OVP04334/1-1751                ---QAQFTDPEYVESRMTQSVHDGIIQRRRPVGKAELIST-HAVISQNPLPATVIG----
  BM45234/1-1465                 ---QAHFTDPEYIEARMTQSVHDGIIQRRRPVGKAELIST-HTVMSQNPLPGVVTG----
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                SI-HGASGNPTTRPPRAPKRGNSGSRSTPMAQSMCSAIGT-TEDEDEEPVESLVATRVRI
  FLYBASE:CG8581/1-1526          -----SLDKRSYVPGYMTTS----------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 SKSTSHSGQDTEEAGSSMSTLERSLAARRAP--RAKLMIPMDAQSNNPAVVSAI------
  SW:P70211/1-1447               SKSASHSGQDTEDAGSSMSTLERSLAARR--ATRAKLMIPMEAQSSNPAVVSAI------
                                                                                             
  
  
  CE26976/1-4280                 PECIQQNGNITQYEFELVGLDEWNEGT---------------------REGVTPRQNTL-
  TMP09698/1-1414                ------------------------------------------------ANGSLSRKRHHL
  SRP08301/1-1589                LRPIVVPSLATIKSLKLASFAFKKEISETNSGDTPSTTATFLSNSENGDCGTLQRSYHH-
  PP54034/1-1392                 ---------------D--------------------------------RSGTLSRSYQH-
  OVP04334/1-1751                ---------------D--------------------------------CNGTLSRSYHQ-
  BM45234/1-1465                 ---------------D--------------------------------CNGTLTRSYHQ-
  CN16484/1-1420                 ---------------Q--------------------------------GPGTLTRSYHQ-
  JA57681/1-866                  ---------------Q--------------------------------GQGTLTRSYHQ-
  CE25115/1-1415                 ---------------Q--------------------------------GQGTLTRSYHQ-
  RP26668/1-1432                 ---------------Q--------------------------------GQGTLTRSYHQ-
  CBP38503/1-1487                ERPVQRAKAIVTGTVQ--------------------------------GQGTLTRSYHQ-
  FLYBASE:CG8581/1-1526          ------------------------------------------------MNGTMERPQY--
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------PVPTLESAQYP-
  SW:P70211/1-1447               ------------------------------------------------PVPTLESAQYP-
                                                                                             
  
  
  CE26976/1-4280                 -IDQLQPGS-LYRIKVRAYTA---EGPGPWSDSLEIRTTGSELGPPRELTAVQTKATQIQ
  TMP09698/1-1414                SSSSVDAA--VLNSPR---SH---VGHSQKVPQVVYTGPKASARAQLLTNDCSASEECVP
  SRP08301/1-1589                SSNSLEIGSQRQRTPQILYTG---TNR-QPIAKIDF---TSTTASDVGSNFSGSTTALPV
  PP54034/1-1392                 STTSLD-Q--RQRTPHMVYGG---HGRG--MGKIDIS--ESPYGSWMGLP-SGTPPP--P
  OVP04334/1-1751                SSTSLE-G--RQRTPQIVYTN---TGRHQ-VAKIDFSDHSSTYSSSQALHISTPPPPQLP
  BM45234/1-1465                 SSTSLE-G--RQRTPQIVYTN---TGRHQ-VAKIDFSDHSSTYSSSQALHISTPPPPQLP
  CN16484/1-1420                 SSQSLE-G--RQRTPQVVYTG---TGRHQPIHKIDF---ESPYGSSSAIG-SASTPPLPP
  JA57681/1-866                  SSQSLE-G--RQRTPQVVYTG---TGRHQPIHKIDF---DSPYGSSSAIG-SASTPPLPP
  CE25115/1-1415                 SSQSLE-G--RQRTPQVVYTG---TGRHQPIQRIDF---ESPYGSSSAIG-SASTPPL-P
  RP26668/1-1432                 SSQSLE-G--RQRTPQVVYTG---TGRHQPIHKIDFD--NSLYGSSSAIG-SASTPPLPP
  CBP38503/1-1487                SSQSLE-G--RQRTPQVVYTG---TGRHQPIHKIDF---DSPYGSSSAIG-SASTPPLPP
  FLYBASE:CG8581/1-1526          --------------PRTQYSH------------------QNRSHMTMEAGLSQQSLTQPQ
  ENSEMBL:ENSP00000389140/1-1447 -------G--ILPSPTCGYPHPQFTLRPVPFPTLSV---DRGFGAGRSQSVSEGPTTQQP
  SW:P70211/1-1447               -------G--ILPSPTCGYPHPQFTLRPVPFPTLSV---DRGFGAGRTQSVSEGPTTQQQ
                                                                                             
  
  
  CE26976/1-4280                 LTWLPPYPEKAIVTAYRIRYSPRADDSNPTEVELSGDDLTCSGYKSPIITSANLCATIKG
  TMP09698/1-1414                SSPMPTPPVSS------------------------------GGGD-----------NHSD
  SRP08301/1-1589                HTPPPQGD---------------------------------ISYS---------------
  PP54034/1-1392                 NLAPPQPPIVTA-----------------------------DGYR-----------SIRD
  OVP04334/1-1751                NQGPPVAPPAQLVCT--------------------------DGYK-----------TLR-
  BM45234/1-1465                 NQGPPVAPPTQLLNN--------------------------DGYR-----------TLR-
  CN16484/1-1420                 VQAPPSGPPTVI-----------------------------DGYR-----------TLR-
  JA57681/1-866                  MQAPPSVPPTVI-----------------------------DGYR-----------TLR-
  CE25115/1-1415                 MQAPPSGPPTVI-----------------------------DGYR-----------TLR-
  RP26668/1-1432                 MQAPPSGPPTVI-----------------------------DGYR-----------TLR-
  CBP38503/1-1487                MQAPPSGPPTVI-----------------------------DGYR-----------TLR-
  FLYBASE:CG8581/1-1526          SNSMAQTPEHPY-----------------------------GGYD-------ANFCNAGN
  ENSEMBL:ENSP00000389140/1-1447 PMLPPSQPEHSSSEE--------------------------APSR-----------TIP-
  SW:P70211/1-1447               PMLPPAQPEHPSSEE--------------------------APSR-----------TIP-
                                     .                                                       
  
  
  CE26976/1-4280                 LQPSTTYRFAVQGQSSSGNWGEWSSDYFSTTRNDDNELLGGSLKLLSAGHDNLKVKWTPP
  TMP09698/1-1414                ASGPTG--------RGSNPLKSFA------------LLSV-PPP--------------PP
  SRP08301/1-1589                GSNVSK--------RPSSHLRSFT------------HLNNIGLSYVNNQQAKTAHIVRPL
  PP54034/1-1392                 ASNIAN--------MPSGGLRSFS------------NING-GLS--------------TV
  OVP04334/1-1751                RNSVNS-----------NPLKSFT------------QLAG-APP--------------PI
  BM45234/1-1465                 RNSVNS-----------NPLKSFT------------QLAG-APP--------------PI
  CN16484/1-1420                 GTPVNS--------SAANALRSFT------------QLAG-A-T--------------PP
  JA57681/1-866                  GTPPNS--------SGANALRSFT------------QLAG-TVT--------------PT
  CE25115/1-1415                 GTPPNS--------SAANALRSFT------------QLAG-A-T--------------PP
  RP26668/1-1432                 GTPPNS----------ANALRSFT------------QLSG-A-T--------------PP
  CBP38503/1-1487                GTPPNS--------SAANALRSFT------------QLAG-A-T--------------PP
  FLYBASE:CG8581/1-1526          AAAGNGCVSTIESSKRGHPLKSFS-------------VPG------------------PP
  ENSEMBL:ENSP00000389140/1-1447 TACVRP----------THPLRSFA-----------------NPL--------------LP
  SW:P70211/1-1447               TACVRP----------THPLRSFA-----------------NPL--------------LP
                                                      .::                                    
  
  
  CE26976/1-4280                 AVIGEKIDKYDIFISVASVLDQNPKKFDVNGQTTDYHFRHLDSVTQYNVTVQGTSEGNKL
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 WFISSVFSTTDFAEGLLNWLPAPTDLHLIEKSDTMLHVDWVPPEIFDPEQRELITHHRVT
  TMP09698/1-1414                -----------------------------------------PPVSS--------------
  SRP08301/1-1589                -----------------------------------------PTSNS----------PIAT
  PP54034/1-1392                 -----------------------------------------R------------------
  OVP04334/1-1751                -----------------------------------------TPTSGSGERMAHVVRPLVI
  BM45234/1-1465                 -----------------------------------------TPSSGSGERMAHVVRPLVV
  CN16484/1-1420                 -----------------------------------------PPHSA--------------
  JA57681/1-866                  -----------------------------------------PPLSG--------------
  CE25115/1-1415                 -----------------------------------------PPHSA--------------
  RP26668/1-1432                 -----------------------------------------PPHSA--------------
  CBP38503/1-1487                -----------------------------------------PPHSA--------------
  FLYBASE:CG8581/1-1526          -----------------------------------------PTGGA--------------
  ENSEMBL:ENSP00000389140/1-1447 -----------------------------------------PPMSA--------------
  SW:P70211/1-1447               -----------------------------------------PPMSA--------------
                                                                                             
  
  
  CE26976/1-4280                 IAPFDPTTGKTGPSKNYTVPYPGNSIKFEGLRPETIYNITVQAGTNSGYGHILWGTYSTL
  TMP09698/1-1414                VSPSS-TGARM----------------------------------------------HLV
  SRP08301/1-1589                STPTAPSNGSP----------------------------------------------GII
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ASPNT-RNGKP----------------------------------------------AGV
  BM45234/1-1465                 ASPNN-RNGKP----------------------------------------------AGV
  CN16484/1-1420                 --PSS-SS-RP----------------------------------------------TII
  JA57681/1-866                  --PPS-AN-RP----------------------------------------------TII
  CE25115/1-1415                 --ASS-SS-RP----------------------------------------------TII
  RP26668/1-1432                 --PSS-SS-RP----------------------------------------------TII
  CBP38503/1-1487                --TST-SSMRP----------------------------------------------TII
  FLYBASE:CG8581/1-1526          --TPV-TKHTP----------------------------------------------AVT
  ENSEMBL:ENSP00000389140/1-1447 IEPKV-PY-TP----------------------------------------------LLS
  SW:P70211/1-1447               IEPKV-PY-TP----------------------------------------------LLS
                                                                                             
  
  
  CE26976/1-4280                 APGQR--HILRLLNRTPTTLNVAWEPVWGRSHSGYTLTARTLYSVYGNVRLQQIKTFDVD
  TMP09698/1-1414                RPTTA--VA----------------PS-AFSSPKGRVNGSGSFGSKGKR------PQAHV
  SRP08301/1-1589                KPYNSHSQTSV--------------PI-GRASAQPRVNMASIYTP----------VSPIK
  PP54034/1-1392                 -------QI----------------PI-GRAQAQPRVNVANLCSPYVSS------SAM--
  OVP04334/1-1751                VIGQKSSHV----------------PV-GRAAAQPRVNVNNIYAPYASC------PVP--
  BM45234/1-1465                 VIGQKSSHV----------------PV-GRATAQPRVNVNNIYSPYASC------VMP--
  CN16484/1-1420                 AAGGR--QV----------------PV-GRATAQPRVNVANIYSPYPS----------SE
  JA57681/1-866                  AAGGR--QV----------------PV-GRATAQPRVNVANIYSPFASC------SAPSE
  CE25115/1-1415                 AAGGR--QV----------------PV-GRATAQPRVNVANIYSPFASC------SASSD
  RP26668/1-1432                 AAGGR--QV----------------PV-GRAAAQPRVNVANIYSQLASC------SASSD
  CBP38503/1-1487                AAGGR--QV----------------PV-GRATAQPRVNVANIYSPFASC------SASSD
  FLYBASE:CG8581/1-1526          IRPQN--QS----------------PY---------------KKPSFSA------ATPNR
  ENSEMBL:ENSP00000389140/1-1447 QPGP---TL----------------PK-THVKTASLGLAGKARSPLLPV------SVPTA
  SW:P70211/1-1447               QPGP---TL----------------PK-THVKTASLGLAGKARSPLLPV------SVPTA
                                                          *                                  
  
  
  CE26976/1-4280                 ASETEFVIRGLHPSTVYNVTLTPKDHNEVAWGAYATLPPGWFVVKNLKQCDKTDFAVSMS
  TMP09698/1-1414                QQQQQ-------------------------------------------------------
  SRP08301/1-1589                NNQNN-------------------------------------------------------
  PP54034/1-1392                 SVEDE-------------------------------------------------------
  OVP04334/1-1751                ----E-------------------------------------------------------
  BM45234/1-1465                 ----E-------------------------------------------------------
  CN16484/1-1420                 AGESD-------------------------------------------------------
  JA57681/1-866                  AG-SD-------------------------------------------------------
  CE25115/1-1415                 AGESD-------------------------------------------------------
  RP26668/1-1432                 AGESD-------------------------------------------------------
  CBP38503/1-1487                AGDSD-------------------------------------------------------
  FLYBASE:CG8581/1-1526          LQGGG-------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 PEVSE-------------------------------------------------------
  SW:P70211/1-1447               PEVSE-------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 WEPVELDMASDYQVRYLRLKEHDGIWTEEEARPAKELLCPKDGCGRLCYLVFNLPHNPTE
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 YVFQVRAKVDGEWNHWKSAPKKMTSSEPLSIRRSCCIVPPPYFVDNIGAPGTFWEVDVNP
  TMP09698/1-1414                ----------------QQPLPTTRSSPSSQRMTGSISGNNGYCGKDA-------DCEVVR
  SRP08301/1-1589                ----------------VIGINDNETDSRYSDSTMGFNQDTNYNHLN----------NLQP
  PP54034/1-1392                 ----------------KMGYKEDDMSNPSHLTL-------------------------HQ
  OVP04334/1-1751                ----------------KATLQLENVIESQPLQA---------------------------
  BM45234/1-1465                 ----------------KAALQRENVIEAQPLQA---------------------------
  CN16484/1-1420                 ----------------KKG-ECMEMKESTPIKT-------NEKMNA----------NMMP
  JA57681/1-866                  ----------------KKG-ECMEMRESTPIKT---------------------------
  CE25115/1-1415                 ----------------KKSGECMEMRETTPIKSNTAGSSNGEKMNT----------NMNP
  RP26668/1-1432                 ----------------KTGVECMEMRETTPIKT----IPPGDKTAN----------NMLP
  CBP38503/1-1487                ----------------KKG-ECMEMRETTPVKT-----TGSDKIVA----------NMLP
  FLYBASE:CG8581/1-1526          ----------------SVVHSTDEIQRLAP------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ----------------ESHKPTEDSANVYEQDD---------------------------
  SW:P70211/1-1447               ----------------ESHKPTEDPASVYEQ-----------------------------
                                                                                             
  
  
  CE26976/1-4280                 AATENNVTRYYVVVDERDPPGDTNWTELTDKVTANKMKIPYYVAASFNLETLPEPRKVRI
  TMP09698/1-1414                SYSTEE------------------------------------------------------
  SRP08301/1-1589                SNSFEE------------------------------------------------------
  PP54034/1-1392                 SISTEE------------------------------------------------------
  OVP04334/1-1751                SASTEE------------------------------------------------------
  BM45234/1-1465                 SASTEE------------------------------------------------------
  CN16484/1-1420                 SHSAED------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 SHSAED------------------------------------------------------
  RP26668/1-1432                 SHSTED------------------------------------------------------
  CBP38503/1-1487                SHSTED------------------------------------------------------
  FLYBASE:CG8581/1-1526          STSTEE------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ----DD------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 GDGSVIGGYLNYPLVKGKKYNYEVYTIWNVTGAPLVGRLRDSNSWGWLFNRILLQWILLP
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                ------------------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 LAAILLLICLIWCISKFCKDRYRSSKEHSRLVTNGQHAPLLEEQKAGMNENMRQLETRLD
  TMP09698/1-1414                -----------------------------------------------LTAQMQNLDNLMQ
  SRP08301/1-1589                -----------------------------------------------INSEMESLNTMIL
  PP54034/1-1392                 -----------------------------------------------LD-EMGDVDIMIT
  OVP04334/1-1751                -----------------------------------------------LNAQMENLDTMID
  BM45234/1-1465                 -----------------------------------------------LNAQMENLDTMID
  CN16484/1-1420                 -----------------------------------------------LNAHLENLDTMLD
  JA57681/1-866                  -------------------------------------------------THQADMLKVGE
  CE25115/1-1415                 -----------------------------------------------LNAHLENLDTMLD
  RP26668/1-1432                 -----------------------------------------------LNAHLENLDTMLD
  CBP38503/1-1487                -----------------------------------------------LNAHLESLDTMLD
  FLYBASE:CG8581/1-1526          -----------------------------------------------LNQEMANLEGLMK
  ENSEMBL:ENSP00000389140/1-1447 -----------------------------------------------LSEQMASLEGLMK
  SW:P70211/1-1447               -----------------------------------------------LSEQMASLEGLMK
                                                                                   .  .:     
  
  
  CE26976/1-4280                 KMRGAVDG-RARGDFEDGYMKGYKDANKLGSAHAARRRLDDDYGTRDDRFHEGYVKGLKD
  TMP09698/1-1414                DLNAISAN----------------------------------------------------
  SRP08301/1-1589                DIRALHHE----------------------------------------------------
  PP54034/1-1392                 DLQALQQE----------------------------------------------------
  OVP04334/1-1751                DLQALQHDILFTHPIHVESWQCYGLLKQCTIVTRAFSDIKLINPDNMNHFCGNYTYSIIP
  BM45234/1-1465                 DLQALQHE----------------------------------------------------
  CN16484/1-1420                 DLQQLQHN----------------------------------------------------
  JA57681/1-866                  KKRKLRKN----------------------------------------------------
  CE25115/1-1415                 DLQQLQHN----------------------------------------------------
  RP26668/1-1432                 DLQKLQSN----------------------------------------------------
  CBP38503/1-1487                DLQQLQHN----------------------------------------------------
  FLYBASE:CG8581/1-1526          DLSAITAN----------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 QLNAITGS----------------------------------------------------
  SW:P70211/1-1447               QLNAITGS----------------------------------------------------
                                 .                                                           
  
  
  CE26976/1-4280                 AGMTGMTTSMHNLAQRTGGGYSAGFAQGYKDGNSGIFGDRVTPSLISRLDEQYAGQEDFK
  TMP09698/1-1414                -----------------------------EFDL---------------------------
  SRP08301/1-1589                ----------------------------FNESI---------------------------
  PP54034/1-1392                 ----------------------------FGVNP---------------------------
  OVP04334/1-1751                CLAYSVNYTDFFITKIFIEFQESVYTGTFFLTTFFQMKQQPGNTPHERFLTFRKCIQNDQ
  BM45234/1-1465                 ----------------------------FSATT---------------------------
  CN16484/1-1420                 ----------------------------LHFDT---------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ----------------------------LHFET---------------------------
  RP26668/1-1432                 ----------------------------F-------------------------------
  CBP38503/1-1487                ----------------------------LHLDT---------------------------
  FLYBASE:CG8581/1-1526          -----------------------------EFEC---------------------------
  ENSEMBL:ENSP00000389140/1-1447 ---------------------------AF-------------------------------
  SW:P70211/1-1447               ---------------------------AF-------------------------------
                                                                                             
  
  
  CE26976/1-4280                 QGYVDGFKEGASSRVGERSRFEDSRKLQQSLTELTERLTSLEKTKGDEIHSTKIYHVYNQ
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                LKHNKSENTMNMIKILRLYLYGCIYNSMTDMLQDSCFNKLVQNCVEKTPTVQKCYYWQCK
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 QPEGATMSSTGAQLAQELEEIGSTSRRSTLRRHYTPGDYLKQDAEEGYNSLSRNRRSLSA
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                SHDFLTLRKSSIDLAIEDEENEDDENINKTSKEKQKLSVKLKVGKLRNFPILRKQTPLSS
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ------------------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ------------------------------------------------------------
  RP26668/1-1432                 ------------------------------------------------------------
  CBP38503/1-1487                ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 SALAANREDKSGKWAEQLIDLVSEPLDTTIARINNYTSSSNDRGQGDVVEEKYHRSYKEE
  TMP09698/1-1414                ------------------------------------------------------------
  SRP08301/1-1589                ------------------------------------------------------------
  PP54034/1-1392                 ------------------------------------------------------------
  OVP04334/1-1751                KMETIEQ-----------------------------------------------------
  BM45234/1-1465                 ------------------------------------------------------------
  CN16484/1-1420                 ---STEK-----------------------------------------------------
  JA57681/1-866                  ------------------------------------------------------------
  CE25115/1-1415                 ---SMDK-----------------------------------------------------
  RP26668/1-1432                 -----NK-----------------------------------------------------
  CBP38503/1-1487                ---STDK-----------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  CE26976/1-4280                 HSSR
  TMP09698/1-1414                ----
  SRP08301/1-1589                ----
  PP54034/1-1392                 ----
  OVP04334/1-1751                ----
  BM45234/1-1465                 ----
  CN16484/1-1420                 ----
  JA57681/1-866                  ----
  CE25115/1-1415                 ----
  RP26668/1-1432                 ----
  CBP38503/1-1487                ----
  FLYBASE:CG8581/1-1526          ----
  ENSEMBL:ENSP00000389140/1-1447 ----
  SW:P70211/1-1447               ----