Welcome to WormBase - need help?
Questions, Feedback & Help
Send us an email and we'll get back to you ASAP. Or you can read our Frequently Asked Questions.

Legend

default*XZ
unknown.
hydrophobicAGLMPV
large hydrophobicFHWY
small alcoholST
cysteineC
negativeDE
polarNQ
positive chargeKR

Protein Alignments

This is the Wormbase protein aligner. To use it, enter a WormBase protein ID.


(e.g. CE25115 or CBP00571)

RP02251(Caenorhabditis remanei)CRE01767
FLYBASE:CG10211(Drosophila melanogaster)Flybase gene name is CG10211-PB
JA48044(Caenorhabditis japonica)CJA00715
CN38022(Caenorhabditis brenneri)CBN08590
TMP12112(Trichuris muris)TMUE_2000006980
CE43668(Caenorhabditis elegans)C46A5.4
OVP00967(Onchocerca volvulus)OVOC4087
SRP05421(Strongyloides ratti)SRAE_X000005100
PP55795(Pristionchus pacificus)PPA10179
BM45891(Brugia malayi)Bm8113
SW:Q3UQ28(Mus musculus)Peroxidasin homolog
ENSEMBL:ENSP00000252804(Homo sapiens)Isoform 1 of Peroxidasin homolog
MUSCLE (v3.8.31) multiple sequence alignment
  
  
  SW:Q3UQ28/1-1475               ----MAVRPTRRCLLALLLCFAWWAMAVVASKQGAGCP----------------------
  ENSEMBL:ENSP00000252804/1-1479 -MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCP----------------------
  FLYBASE:CG10211/1-1394         -------MRKPEMLISLILWCLCASS----------------------------------
  CN38022/1-1295                 --------MTMIFFFLLLITCSLVSGAF--------------------------------
  BM45891/1-1491                 ------MSLKLCIWISLQIIIPNGYADKTAEEKTIDKILLNAFNDARQNIDELK------
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 --------MRKRLLFLLILFSTCSASPFPCGPSFVPCTQKRAFSSLIHSPNKQFNKEFGV
  OVP00967/1-1231                ------------------------------------------------------------
  PP55795/1-1450                 ----MRPFPAPLLFLPFLLLQNAPTDAATCNPLIVRCR-----TN-----EALSTQFVID
  SRP05421/1-1534                MKIIINLWRNILIFIILFLSFFLIYSQIPCGKSFVSCE-----NSIFERKNAIDYNIIEG
  JA48044/1-1261                 ------------------------------------------------------------
  CBP00571/1-1491                -------MRRLVLYLLVFAGSSIVASNIPCGKSFIPCE-----NDILNHQQGLN------
  RP02251/1-1489                 -------MRRLVLYLLVFGGSSVYASNIPCGKSFIPCE-----NDILNHQQGL-------
                                                                                             
  
  
  SW:Q3UQ28/1-1475               -----------------------------SRCLCFRTTVRCMHLLLEAVPAVAPQTSILD
  ENSEMBL:ENSP00000252804/1-1479 -----------------------------SRCLCFRTTVRCMHLLLEAVPAVAPQTSILD
  FLYBASE:CG10211/1-1394         ------------------------------------------------------------
  CN38022/1-1295                 --------------------------------------GRNYHESNFDLASQAAQAEILP
  BM45891/1-1491                 -----------------------------QFYDESILTQNVMEQIQIPF-----------
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 EFGKHFDSEPSEKVKNEFKKSMKQEIITTAASSAVRLTEKLFNDTEKLMSDKFDDSFKQS
  OVP00967/1-1231                ------------------------------------LTQ---------------------
  PP55795/1-1450                 ALPPHLDPPNSAKERAVMESLLQIDLFFTRTQAELLRKSNVVDPLRVPY-----------
  SRP05421/1-1534                HIYKIDGSVTTTLTSNTNKILIDEDMILTASHQAEMALLNNMKEKKFIDKPNDKLIKDSI
  JA48044/1-1261                 ------------------------------------------------------------
  CBP00571/1-1491                ---GIDEGAFVSHR-------VPEGLLFVAAKEGERESSKLFDFRDVAFQYSGHPLSTST
  RP02251/1-1489                 ----IDEGAFVSHR-------VPDGLLFVAAKEGERESAKLFDFRDVAFQYSGHPLSTST
                                                                                             
  
  
  SW:Q3UQ28/1-1475               LRFNRIREIQPGAFRRLRSLNTLLLNNNQIKK------------------------IPNG
  ENSEMBL:ENSP00000252804/1-1479 LRFNRIREIQPGAFRRLRNLNTLLLNNNQIKR------------------------IPSG
  FLYBASE:CG10211/1-1394         --------LTLRIPEDLENAAINALSSERARS------------LTPCGSSAEAEGSVAG
  CN38022/1-1295                 FRRHTPFSQEDSLMVNYSIAALTAIKVSQASS--------------DLHQKLPQHLCPLK
  BM45891/1-1491                 -KIWNLHTTNQLNAQKLSHAALHSIAATKKLK----NDGIKIDNNLPIILKYINEYCPLN
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 ELAWLHYTYADQYAKYLSFSAISSTLASQMISEKSPKTLKSMIQFLPTENTKMKEICPVN
  OVP00967/1-1231                ------------------------------------------------------------
  PP55795/1-1450                 ----RLYSTQNGWDDEARMRFFVALVAEEATE------KLPRNTTRDTRGTVLEKICPLH
  SRP05421/1-1534                MRYIEVTSQEYQKNNLINGSNLNTALSKELKTMGLNLVDLKIIKIPENISNIMSEICIKN
  JA48044/1-1261                 ------------------------------------------------------------
  CBP00571/1-1491                SQFTRIHKADKKASDRSRSAFTSVAITKRLTALGLRERELKYGLPPNQISSTISN-CPIP
  RP02251/1-1489                 SQFTRIHKADKKASDRSRSAFTSLAITKRLTALGLRERELKYGLPPNQISSTISN-CPIP
                                                                                             
  
  
  SW:Q3UQ28/1-1475               AFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPESF-QHLPKLERL
  ENSEMBL:ENSP00000252804/1-1479 AFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSF-QHLPKLERL
  FLYBASE:CG10211/1-1394         DYDVCPPSKYRQPTAECNNVSHRKWGARGDIFQRLLAADYADGVSQPRTS-KGTHALPDA
  CN38022/1-1295                 KYK-CIYGDYRRFDGRCTNIFFPLSGSAYSSFSRRLLASYDDNISVPRFHGSRNRLLPPP
  BM45891/1-1491                 EIK-CTISKYRTIDGTCNNIIHSNWGAIGMPMQRIIEPFYANGIDELRTSIIDNSELPNV
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 QIEECVIGKYRSYTGHCNNVKNPLNGASYERLKRFLPADYSDGISAPRSS-KSGQPLPSS
  OVP00967/1-1231                ------------------------------------------------------------
  PP55795/1-1450                 ENEECASTKYRSADGLCNNVRHTDWGAAYSRMQRYLPSVYPHTIA---GQ-PTHPHLPSS
  SRP05421/1-1534                KKNFCTPSSYRTINGECNNVNNPTLGSVYEPFQRILSPDYEDYIMLPRSS-YKKEQLPNE
  JA48044/1-1261                 ------------------------------------------------------------
  CBP00571/1-1491                TINHCFATNYRSFSGICNNVAHPEWGASHTPMARIMRPDYADGVSEPRAA-AASKPLPSV
  RP02251/1-1489                 TIDHCFATNYRSFSGICNNVAHPEWGASHTPMARIMRPDYSDGVSEPRTA-AASKPLPSV
                                                                                             
  
  
  SW:Q3UQ28/1-1475               FLHNNRITHLVPGTFSQLESMKRLRLDSNALHCD-CEILWLADLLKTYAQSGNAQAAATC
  ENSEMBL:ENSP00000252804/1-1479 FLHNNRITHLVPGTFNHLESMKRLRLDSNTLHCD-CEILWLADLLKTYAESGNAQAAAIC
  FLYBASE:CG10211/1-1394         EVVIEQLQRHVEGELRHAHITAMLPAWGQLLANDLVEVGQLPISG------------KCC
  CN38022/1-1295                 GIVEKQIARVPA--AFPIPISKLFIEVSEFLYSDLASFVKIQEGL------------GCC
  BM45891/1-1491                 LHLSNLFFMMNH--STALNINMLNALWAHFIYTDLVHTSSLQLLT-----DEVEILLPCC
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 RALS-ALFTPSP--SGHATCSLLIAPFLSFIYDDIVHVPSNRIFKRDFYGNDKAMPLPCC
  OVP00967/1-1231                ------------------------------------------------------------
  PP55795/1-1450                 RRVSSTLFKQQRF-PQEIRLTQLVAHFSHFVYADLVQIAKPRIET-----DTISHALPCC
  SRP05421/1-1534                RELTTKLFNYKN--DRNVTISNLFAYWFHLISSDISLISSITKTS-----SGEDIIPQCC
  JA48044/1-1261                 ----------------------MMALWMQLIASDMVNVVPFQAVN-----EGTSSALPCC
  CBP00571/1-1491                RSLSLTLFTPRG--EVHSEVTTMMGLWMQLIASDMVNVVSFQAVN-----EGTSSALPCC
  RP02251/1-1489                 RSLSLTLFTPRG--EVHSEVTTMMGLWMQLISSDMVNVVSFQAVN-----EGTSSALPCC
                                                                                             
  
  
  SW:Q3UQ28/1-1475               EYPRRIQGRSVATITPEELNC-ERPRITSEPQDADVTS--GNTVYFTCRAEGNPKPEIIW
  ENSEMBL:ENSP00000252804/1-1479 EYPRRIQGRSVATITPEELNC-ERPRITSEPQDADVTS--GNTVYFTCRAEGNPKPEIIW
  FLYBASE:CG10211/1-1394         ERDSAVKDPS------ELQHCFVRAGPDCKEYKRSAPGFDLEACQKHTRQQMNIASAYID
  CN38022/1-1295                 GSGSV---GECLSIGDLFHDC----------YIRSAPS-PLKHCSLGQREQMNVATAFID
  BM45891/1-1491                 GTKFKQ-HSECKPIMVPKNDPNYSNLPDCLSYTRTAPA-PHPNCKLGSREQANQVTSFLD
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 RGDNSH--PECFEIPVPEDDTLQSKNVKCLPYSRSLPV-PNPKCSFGQRQQANMVTSYLD
  OVP00967/1-1231                ----------------------------CLPYVRTATS-PRENCSLGPREQVNQATSFLD
  PP55795/1-1450                 DPAMAH--PECTSIDVAANDTRFLGFIRCMPYARTTSA-PNRACDLGERQQANLATSFLD
  SRP05421/1-1534                SPNTKKMDNECDPLEISSSDSIYRGLVTCIPYTRSIPT-IPKNCNLGQREQANFVTSYID
  JA48044/1-1261                 KRGFNH--SECDVIDIPSADPAYRTRLNCIPHARSTIA-PREACRLGPREQANFASSYLD
  CBP00571/1-1491                KRGFNH--SECDVIDIPAADPAYRTRLNCIPHSRSIIA-PREACRLGPREQANFASSYLD
  RP02251/1-1489                 KRGFNH--SECDAIDIPAADPAYRTRLNCIPHARSIIA-PREACRLGPREQANFASSYLD
                                                                                             
  
  
  SW:Q3UQ28/1-1475               LRNNNELSMKTDSRLNLLDDGTLMI--------------QNTQEADEGVYQCMAKNVAGE
  ENSEMBL:ENSP00000252804/1-1479 LRNNNELSMKTDSRLNLLDDGTLMI--------------QNTQETDQGIYQCMAKNVAGE
  FLYBASE:CG10211/1-1394         GSGLYGSTRHEFDQLRTYISGGVKVES----------------------CK-----YCQV
  CN38022/1-1295                 AGPIY-------QNWRDLSKGTIESDF-------------------------SLESSSSS
  BM45891/1-1491                 ASIIYGTTIQQARAIRTFKNGHLLTNLNLMNSNISPTISTFCNLLQITIANCDLTNKYYS
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 LSQIYGSTEGIVKKMRLHKNGKLALRAVGGF-NNQLGVPPANLDSSI--CRSSTGKPCLL
  OVP00967/1-1231                ASHIYGSNVEHANKLRAYRDGLLLTQKSSRQ-NILL---PTTNDGTC--WNNRNPQRCFL
  PP55795/1-1450                 ASLVYGSEPLLARKLRAHNHGLLLTTY-SSSPDFSL---PLEAPRTH--CA-DGARSCFL
  SRP05421/1-1534                GSSIYGISINNEKELREYVNGKLKTVI-FNN-DSEL---LSADITTSEWCQLSSNYSCFK
  JA48044/1-1261                 ASFIYGSNMERAKQLRTFRNGQLRTA---GS-IGEL---PATDGTLQ--CQ-ATHSRCAL
  CBP00571/1-1491                ASFIYGSNMEKAKQLRTFRNGQLRTA---GS-IGEL---PATDGTLQ--CQ-ATHSRCAL
  RP02251/1-1489                 ASFIYGSNMEKAKQLRTFRNGQLRTA---GS-IGEL---PATDATLQ--CQ-ATHSRCAL
                                                                                             
  
  
  SW:Q3UQ28/1-1475               AKTQEVTLRYLGSPARPTFVIQPQNTEVLVGESVTLECSATGHPLPQITWTRGDRTPLPI
  ENSEMBL:ENSP00000252804/1-1479 VKTQEVTLRYFGSPARPTFVIQPQNTEVLVGESVTLECSATGHPPPRISWTRGDRTPLPV
  FLYBASE:CG10211/1-1394         AG---------ATGALHRALLQQHNNIGERLSHINPDWSEEDVFLEARRIITATIQHITY
  CN38022/1-1295                 SSLHSPSF-SSPISSFHRLLIDEHNWVVQKLQKTYPGVQMNILFEEARKFVIAEVQHIIF
  BM45891/1-1491                 LNSNHLNF-LQSIIILRNIWLRQHNRIATNLKIINSHWSDEQLYQESRRIVIAQLQHITF
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 AGNNKINF-LPTSGAIYTIWMRQHNVIADKLASVNPHWDDQKVFEEARRITIAQFQHITF
  OVP00967/1-1231                AGGEFTNL-FSTHTALHTIWLRQHNNIAKQLKAINADWDDEKLFQESRRIVIAQIQHITY
  PP55795/1-1450                 GGSNQINF-LPTSAALHTIWLRQHNRLVKDLETMNPNWSDMKLYQEARRIVIAQLQHVTY
  SRP05421/1-1534                TGTKDGNI-FPGSSTLRTILVKYHNYIAINLKKLNPFWDDEKIYQESKKIIIGKIQFITY
  JA48044/1-1261                 SGSDEVNL-LPSITALHTVFIRHHNRITDSLRSLNRHWTDDKLYEEARKIVSAQVQHITY
  CBP00571/1-1491                SGSDEVNI-LPSVAALHTVFIRHHNRLSDNLRSINRHWTDDKLYEETRKIVSAQIQHITY
  RP02251/1-1489                 SGTDEVNI-LPSVAAIHTVFIRHHNRLADNLRSINRHWTDDKLYEEARKIVSAQVQHITY
                                                                                             
  
  
  SW:Q3UQ28/1-1475               DPRVNITPSGGLYIQNVAQSDSGEYTCFASNSVDSIHATAFIIVQALPQFTVTPQSRVVI
  ENSEMBL:ENSP00000252804/1-1479 DPRVNITPSGGLYIQNVVQGDSGEYACSATNNIDSVHATAFIIVQALPQFTVTPQDRVVI
  FLYBASE:CG10211/1-1394         NEFLPLVLGQETTAKEGLRLTAEKHSSNYSSSVRGGIYNEFATAAMPAFWSMYPPE----
  CN38022/1-1295                 EQFLPILLGEETIEKYDLRAPHCDKELCHE--VEANTLNEYGSAVGLFHKFMTAADKS--
  BM45891/1-1491                 NEFLPNLIGKKNWLKFNLQSETIGYSNNYNDNTDSTIINTYATTAGQFFVTMFGKYFQWH
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 NEMVPVLVGKEQLRVMGIKLQKNGYDSGYDINIDSSASNVFASAAGQFFLTLLPSQFNIE
  OVP00967/1-1231                NEFLPIIVGKNNLRQYGIKLRHSDYDSDYDLKTDATALNEYASAIGLFFYSLFSDHIFLH
  PP55795/1-1450                 NEWLPVLMSREIWAEYKLKGERSCYTSGYSTSVDPSVLNSYAAVVGQFFFTMFGAKIEHL
  SRP05421/1-1534                NEFLPILLGEKNMIKYKLKLRNYGYESNYDITINSNVFNEVSILLNPLLFSMINEMIRLV
  JA48044/1-1261                 NEFLPILLGRENMRNYGLTLHSTGFDSNYEMNLEANTFNEFSVTVPYYFWALLPAEGSFS
  CBP00571/1-1491                NEFLPVLLGRENMRNYGLNLHSAGFDSNYEMNLEGTTFNEFAVTVPYYFWALLPSEKSFV
  RP02251/1-1489                 NEFLPVLLGRENMRNYGLNLHSAGFDSNYEMNLEGTTFNEFAVTVPYYFWALLPSEKSFV
                                                                                             
  
  
  SW:Q3UQ28/1-1475               E----------------------------GQTVDFQCAAKGHPQPVIA-------WTKGG
  ENSEMBL:ENSP00000252804/1-1479 E----------------------------GQTVDFQCEAKGNPPPVIA-------WTKGG
  FLYBASE:CG10211/1-1394         -----------------------------------MLAKKMSAHELLSIAALQKSLVPSQ
  CN38022/1-1295                 ---------------------------------SFVLLKQIFNPSHYMATEFSTLQTSST
  BM45891/1-1491                 KN-DGIKILERSLNEYFNDPELLFSKDQTRDLLRYVLREPINESLTYTNDKFYNNFFKRN
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 D--KRFSTKSESLLKHFNDPALIYEKGRIDGMLKFLLNAPIEKPGLHSSPLLRTAFQKKD
  OVP00967/1-1231                EDEEGNRKTKKSWSAIINNPELLYN-GKIDAILRYLLRETISKPGLHMNNYFKNEFLRGK
  PP55795/1-1450                 DA-IDRPLLERPISEIYNDPASLFMSDNIGGLLR----PENGPQELFMSDNI-GGLLR--
  SRP05421/1-1534                DN-KGWIIKNFNIGDTFNDPSLLYEKDGIENIIRFLTLEKINPPSLLIPEIFKSYYLSKR
  JA48044/1-1261                 D---------------FNNPSKLYEQGPVQ-ILRQVLNTNIYQSTLRANDEVKSGFLKDN
  CBP00571/1-1491                D---------------FNNPSRLYEQGPIQ-IIRQLLTTNIYQPALRANDEVKSGFLKDN
  RP02251/1-1489                 D---------------FNNPSRLYEQGPIQ-IIRQLLNTNIYQPTLRANDEVKSGFLKDN
                                                                                             
  
  
  SW:Q3UQ28/1-1475               SQLSVD-RRHLVLSSGTLRISGVALHDQGQYEC------QAVNIIGSQKVVAHLTVQPRV
  ENSEMBL:ENSP00000252804/1-1479 SQLSVD-RRHLVLSSGTLRISGVALHDQGQYEC------QAVNIIGSQKVVAHLTVQPRV
  FLYBASE:CG10211/1-1394         TNAEGWSELALAVHRG--RDHGVASYVHALDLCERRFADQSAANVSFDTLAQVSNIPEEY
  CN38022/1-1295                 ASDVLSPKLSELILRG--RDHGIATYAQWRKEC------GGGELESYEQL--IGMIDDRI
  BM45891/1-1491                 KNLASE-FIALILQMG--RDHGIPPYTVWREYC------NGSKIQSFDDLMDDLIDGTEM
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 IADSVD-IIAMVIQMG--RDHGLPSYLQWRTFC------KLDDFSSFLALQTIFKPSVNI
  OVP00967/1-1231                GNYGLD-LAAMIIQMG--RDHGVPGYTAFRSAC------GLRQPANFSDLADIILESLDL
  PP55795/1-1450                 ---------FLVRRKT--SMPGVHMNDELRDR--------LYKIDSFVQLRPELTDGVRM
  SRP05421/1-1534                GNFGLD-SISLAIKKG--RDHGIKGYRFYRQAC------GLSDITNFNDLEKIFYSKDVV
  JA48044/1-1261                 HEFGLD-LVSIALKQG--RDHGIPGYTTIRATC------GLGRIASFNDLREIFLPEVKF
  CBP00571/1-1491                HEFGLD-LISIALKQG--RDHGIPGYTAIRASC------GLGRIASFNDLREIFLPEVKF
  RP02251/1-1489                 HEFGLD-LISIALKQG--RDHGIPGYTALRASC------GLGRIASFNDLREIFLPEVKF
                                                                                             
  
  
  SW:Q3UQ28/1-1475               TPVFASI---PSDMTVEVGTNVQLPC-SSQGEPEPAITWNKDGVQ--------------V
  ENSEMBL:ENSP00000252804/1-1479 TPVFASI---PSDTTVEVGANVQLPC-SSQGEPEPAITWNKDGVQ--------------V
  FLYBASE:CG10211/1-1394         ITNLRDIYQNANDIDLLVGALLEEPVVGALFGPTISCLLSLQFEQ--------------L
  CN38022/1-1295                 LKSVRDIFPDIRDVDLIILGVAENPVYGSLLGPTFGCIMALQLQKVIFEAQPNINALLQT
  BM45891/1-1491                 IKELSKLYKTVDDMDLFLLGLIEKPLNDAIVGPTFSCIISLQFQK--------------T
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 S-DFERLYESPEDIDVFVGGLSEQPTKGSLLGPTFACLFAHQMAQ--------------T
  OVP00967/1-1231                D-ELAKLYDHIDDVDLFVLGMAEKPEVGALVGPTFACIIGKQFQK--------------I
  PP55795/1-1450                 SAELQKLYRRVEDVDLFVGGLAEKPVKGGLVGKTFACILGHQFQK---------------
  SRP05421/1-1534                N-ILSSLYDNINDVELIIGSLGEKPIDGSLLGPTLSCILGKQFEI--------------L
  JA48044/1-1261                 E-QVASAYERVEDIDLLVGVLAEKPLKGSLVGPTMACIIGKQMQR--------------T
  CBP00571/1-1491                E-HLSAAYSRVEDVDILVGVLAEKPLKGSLVGPTMACIIGKQMQR--------------T
  RP02251/1-1489                 E-HLSSAYQRVEDIDLLVGVLAEKPLKGSLVGPTMACIIGKQMQR--------------T
                                                                                             
  
  
  SW:Q3UQ28/1-1475               TESGKF----HISPEGFL--TINDVGTADAGRYECVARNTIGYASVSMVL----------
  ENSEMBL:ENSP00000252804/1-1479 TESGKF----HISPEGFL--TINDVGPADAGRYECVARNTIGSASVSMVL----------
  FLYBASE:CG10211/1-1394         KQTDRFWYENEIPPSSFTLDQLKSIRQTTLSGLLCGSHQ-VSTAQSKAFILEDNYLNSIL
  CN38022/1-1295                 KFGDSYWYTN-----RLNKEQIEEVEKVSISGMI----------------------NIPL
  BM45891/1-1491                 KTGDRYWYENNFEEIRFSDEQLMEIRKITMAKIFCSNVKSFDKIQSKVFELENDYDNYPI
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 KRGDRFWYENFVSPSAFTVDQIDEIRKTTMARIICDNTDTVTHVQHHAFSLPDDYGNCPL
  OVP00967/1-1231                RRGDRFWYENFFAPSAFTLEQLGEIRKTTLARIVCDNLEGINEIQPNVFTLADIYGNCPM
  PP55795/1-1450                 ---------NGMAPSQFTEKQLMEIRKTTMARIICENGR-LETIQPHAFEMEDDFDNNAV
  SRP05421/1-1534                KYGDRYWFENYFTDSSFTIKQLDEIRKSSISEIICVGSN-INSLQPNTFLLPDKFSNTFL
  JA48044/1-1261                 RRADRFWYENYFAQSGFTEAQLSEIRNTKLAEIICSNVD-IRRIQRNVFFREDVFDNMAI
  CBP00571/1-1491                RRADRFWYENYFAQSGFSEGQLSEIRNTKLAEIICANID-IRRIQRNVFFREDEFDNMAI
  RP02251/1-1489                 RRADRFWYENYFAQSGFSGGQLSEIRNTKLAEIICSNID-IRRIQRNVFFREDVFDNMAI
                                                                                             
  
  
  SW:Q3UQ28/1-1475               ------SVNVPDVSRNG--------------DPYV-ATSIVEAIATVDRAINSTRTHLFD
  ENSEMBL:ENSP00000252804/1-1479 ------SVNVPDVSRNG--------------DPFV-ATSIVEAIATVDRAINSTRTHLFD
  FLYBASE:CG10211/1-1394         DCD---QLPKFDLKPWQVNPEDEVHVEHVEVEPATKEAIAELSPELIEAAVERAKQELEE
  CN38022/1-1295                 FCNSS-VFSMPDFTKWI--------------ATDE-----KPRNSEFDDVLDECTLEVKR
  BM45891/1-1491                 YCNET-VHADTNIAKWL--------------DKSNYKLNLPLTEEKIEKAIEIAIEGVKQ
  TMP12112/1-740                 ------------------------------------------------------------
  CE43668/1-1537                 SCNSTGIIQVFDPKAFK--------------DEEK-LTSLPITKETVEKVIRLGLRQWQR
  OVP00967/1-1231                HCNST-IIDTIDLTQWI--------------DQEP-RLKLPITKATLEKAVRLGAEHAKR
  PP55795/1-1450                 PCE---MMHTLDLSHWR--------------DESN-SLEIPVSMESVKKAFEIGQKEVEE
  SRP05421/1-1534                NCNNN-AINKMKFKYWK--------------DDEK-KIEIPITKETIEKVFDLAELNVKE
  JA48044/1-1261                 SCNSS-VLSGPNFNEWR--------------DAEG-KPVFPIRQETIEKVITLAKRNLKD
  CBP00571/1-1491                SCNST-VLSSPNFNEWR--------------DAEG-KPVFPIRQETIEKVISLAKRNLKD
  RP02251/1-1489                 SCNST-VLSSPDFNEWR--------------DAEG-KPVFPIRQETIEKVISLAKRNLKD
                                                                                             
  
  
  SW:Q3UQ28/1-1475               SRP-RSPNDL------------LA--LFRYPR----DPYTVGQARAGEIFERTLQLIQEH
  ENSEMBL:ENSP00000252804/1-1479 SRP-RSPNDL------------LA--LFRYPR----DPYTVEQARAGEIFERTLQLIQEH
  FLYBASE:CG10211/1-1394         RKR-FEYEVW-RT--KGGISARSP--DGTAASFSKANLAALNLANSSLIFELTSNEIVKT
  CN38022/1-1295                 ARSYRKPKTL-----QDGLHDSVA--LKSYGSMMLAKDEAVNEANISFILLEATKKLVKH
  BM45891/1-1491                 RQK-RERRNIRKN--QDLFKSGDP--LLSYGKMMRAKNEAIAISRVSDVFLQATKNILSI
  TMP12112/1-740                 ---------------------------------MSPSQEALDIARTADILLEATKVLIND
  CE43668/1-1537                 YEE-GEGRRI-----SAQLSDSSPSALLSHALLMAPKKESIDIARTASVLREATNILISG
  OVP00967/1-1231                LNE-AEADRIRRQGRSGNANRSQKLAVYAHSNLLAPKKESLEISHRAEVLREATKVLLRG
  PP55795/1-1450                 RRR-RETHNIKRN--QAAFKDGDP--LLSYGKMMRAKREAIELSQISKILLASSQALLND
  SRP05421/1-1534                RIK-RELKNINVN--QTNFQKGDP--LYAWSNMLRPKERSKEIGKIAEILLESTKILINN
  JA48044/1-1261                 QER-REISNLKHN--QGRFVKGDP--LFAYSNMMRAKEGAKQVSQISALLLETTKLLIKG
  CBP00571/1-1491                QER-REISNLKHN--QGRFQKGDP--LFAYSNMMRAKEGAKQVSQISALLLETTKLLIKG
  RP02251/1-1489                 QER-REISNLKHN--QGRFQKGDP--LFAYSNMMRAKEGAKQVSQISALLLETTKLLIKG
                                                                     .  :   .. . ::  : : :   
  
  
  SW:Q3UQ28/1-1475               -----VQHGLM-------VDLNGTSYHYNDLVSPQYLSLIANLSGCTAHRRVNNCSDM--
  ENSEMBL:ENSP00000252804/1-1479 -----VQHGLM-------VDLNGTSYHYNDLVSPQYLNLIANLSGCTAHRRVNNCSDM--
  FLYBASE:CG10211/1-1394         LNHITRRKRQIFNPNQNAFNRNELTDTLQTVDISGLLGGAQKQL--------DTCPEPSQ
  CN38022/1-1295                 KN----------------VALSSIQGV--------YIGEGDKYNVS------DQCTPKDL
  BM45891/1-1491                 IGTENNKELLGEV-----NDINEMQNLLQQIDVSSFISRIEPFLGRGGSV--EKCLPRNL
  TMP12112/1-740                 -EQLGQKNTPGLK-----LDITTLQKMLPRIEIRSFIANATGNN--------QRCNRKLF
  CE43668/1-1537                 -NGLDKDERLP-D-----LDIGTLQKILPQIDVGSVIGNFTPFLARD-PLPKEQCLPEPL
  OVP00967/1-1231                -DGLSEQERLPLE-----LDLPTLQRLLPEVDVSYFVGNITDFLGEE-NPSIEECLPRPL
  PP55795/1-1450                 QQALIGKDGLPLK-----LDRRTLQTILPQIDVSEFIGNFTALLGDQGSVNK--CLPRSL
  SRP05421/1-1534                -NNLPGGEKLP-K-----LSIEHIQKMLPEIDVSRFIFNYTAFLSDNGRLTKDQCLPQNL
  JA48044/1-1261                 -EGLDTDEQLP-K-----LDTNTLQKILPDIDVTSFVNNYTAFLSEDGQSSQEECSPKML
  CBP00571/1-1491                -EGLDTDEQLP-K-----LDTNTLQKILPDIDVTSFVNNYTAFLSEDGQASQEECSPKML
  RP02251/1-1489                 -EGLDTDEQLP-K-----LDTNTLQKILPDIDVTSFVNNYTAFLSEDGQASQEECSPKML
                                                                     :                 *     
  
  
  SW:Q3UQ28/1-1475               -CFHQK-YRTHDGTCNNLQHPMWGASLTAFERLLKAVYENGFNTPRGINSQRQYNGHVLP
  ENSEMBL:ENSP00000252804/1-1479 -CFHQK-YRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRGINPHRLYNGHALP
  FLYBASE:CG10211/1-1394         QCDANSPFRTLSGRCNNLRNPNWGKSLTTFSRLLPAQYEDGISAPR---LTGV-TGTALP
  CN38022/1-1295                 PCDSTNPYRSYTGWCNNLEFPSYGNTFRELKRLLPPDYDDQIDLPR---SKST-SGARLP
  BM45891/1-1491                 PCDDVTRYRTMSGWCNNLQNPRFANAFGPLIHLLPPAYDDGIDMPR---SKSI-TGDLLP
  TMP12112/1-740                 PCDPTSPYRTITGWCNNLRNPENGMAFSPFRRLLKPLYSDGFSEPR---KFSI-DGSLLP
  CE43668/1-1537                 PCDHTSKYRTYSGWCNNLKNPKFGNAFTQMRRLLDPAYDDGFDTPR---TRSV-LGSELP
  OVP00967/1-1231                PCDHTTKYRTFSGWCNNLKFPHYGNAFAPMRRLLDPVYEDGFDSPR---IMSRNRGRKLP
  PP55795/1-1450                 PCDHTSPYRTYSGWCNNLFNPQFGNAFGPLRHILKPSYEDG-------------------
  SRP05421/1-1534                PCDHTNKYRIYSGWCNNLKHPEYGNAFQPLKHLLTPVYDDGFDKPR---IKSI-TGKLLP
  JA48044/1-1261                 PCDHTTRYRTFSGWCNNLKFPEYANSFAPLRHLLPPQYDDGFDAPR---TRAK-SGRPLP
  CBP00571/1-1491                PCDHTTRYRTFNGWCNNLKFPEYANSFAPLRHVLPPQYEDGFDAPR---TRAK-SGRPLP
  RP02251/1-1489                 PCDHTTRYRTFNGWCNNLKFPEYANSFAPLRHVLPPQYDDGFDAPR---TRAK-SGRSLP
                                  *   . :*   * ****  *  . ::  : ::* . *.:                    
  
  
  SW:Q3UQ28/1-1475               MPRLVSTTLIGTEVITPDEQFTHMLMQWGQFLDHDLDSTVVALS-QARFSDGQHCSSVCS
  ENSEMBL:ENSP00000252804/1-1479 MPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALS-QARFSDGQHCSNVCS
  FLYBASE:CG10211/1-1394         NPRTISTTIHPDISNL-HTRYSLMVMQFAQFVDHDLTLTPIHKGFHESIPSCRPCNSRQT
  CN38022/1-1295                 SPRAISNVVHHSKKIE-HVKYSHFVMEFGQFIDHDITHSPVDQNSDGTPLNCSKCDSNRD
  BM45891/1-1491                 SARVISNAIHFDLPIT-YQNYSHMIMQFGQILDHELTHSPIEHGPDNEILNCTRCDSNEI
  TMP12112/1-740                 NARKVANVMHPSKDVI-HKKYSHFLMMFGQFLDHDMTHTPMTVAPDGSPLECSACNSSET
  CE43668/1-1537                 SARKISNIVHSDAPKF-HVKFTHMLMQFGQILDHDMMHSPISRGPKNTILNCSSCDSAQT
  OVP00967/1-1231                SARKVSNAVHAEAPVF-HAVYTHMLMQMGQIIDHDFAHSPVSRGPGNAILDCSRCDSAKT
  PP55795/1-1450                 -------------------RYSLMIMQFGQLLDHEVTHSPTERGPNDEILNCTRCDSPTT
  SRP05421/1-1534                NPRIISNKIHEDKNIS-HVKFTHMVMQFGQFLDHDLTHSPTSRGPNNEILNCTRCDSPET
  JA48044/1-1261                 NPRRVSNSVCEDKDVS-HVKFTHMVMQFGQLLDHELTHSPVARGPNDEILNCTKCDSPEK
  CBP00571/1-1491                NPRRVSNLVCEDKDVS-HVKFTHMVMQFGQLLDHELTHSPVARGPNDEILNCTKCDSPEK
  RP02251/1-1489                 NPRRISNLVCEDKDVS-HVKFTHMVMQFGQLLDHELTHSPVARGPNDEILNCTKCDSPEK
                                                     :: ::*  .*::**:.  :           .   *..   
  
  
  SW:Q3UQ28/1-1475               NDPPCFSVMIPPNDPRVR------SGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQL
  ENSEMBL:ENSP00000252804/1-1479 NDPPCFSVMIPPNDSRAR------SGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQL
  FLYBASE:CG10211/1-1394         VHPECNPFPVPAGDFYYPEVNVTSGERFCFPSMRSLP----GQQSL-----GPRDQINQN
  CN38022/1-1295                 ISPSCFPIPVPVNDLHFE-PYS------CLSFVRSLP----AQKTL-----GHRNQMNQV
  BM45891/1-1491                 LSMHCMPLPIPLNDPFFP-IYDENGKRRCLPFTRSLL----GQLNL-----GYRNQINQL
  TMP12112/1-740                 VSSNCWPIPIPHDDPHFP-PTMPDGSPRCMHFVRSLI----GQLTL-----GYREQLNQL
  CE43668/1-1537                 LSIHCFPIKIEANDPFFP-SKHSDGRPRCMPFARSLL----AQVSL-----GFRNQLNQL
  OVP00967/1-1231                VSIHCFPIPIESGDPYFP-HLLDNGEPRCIAFTRSLL----GQLTL-----GYRNQLDQL
  PP55795/1-1450                 LSVHCMPLPVPEGDPHFP-THF-NGERRCLPFARSLL----GQLNL-----GYRNQLNQL
  SRP05421/1-1534                ISVHCSPIPIEIGDPHFP-THYPNGEKRCLPFARSLL----GQLNL-----GYRNQLNQL
  JA48044/1-1261                 ISVHCMPIRVEKDDPFFP-THYPNGEPRCLPFARSLL----GQLNL-----GYRNQLNQL
  CBP00571/1-1491                ISVHCMPIRVEKDDPFFP-TNYPNGEPRCLPFARSLL----GQLNL-----GYRNQLNQL
  RP02251/1-1489                 ISVHCMPIRVEKDDPFFP-TNYPNGEPRCLPFARSLL----GQLNL-----GYRNQLNQL
                                     * .. :  .*              *:   **      .  .*       *:*::* 
  
  
  SW:Q3UQ28/1-1475               TSYIDASNVYGSTDHEARSIRDLASHRGLLRQGIVQ----RSG-KPLLPFATGPPTECMR
  ENSEMBL:ENSP00000252804/1-1479 TSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQ----RSG-KPLLPFATGPPTECMR
  FLYBASE:CG10211/1-1394         THFLDGSMVYGETTCLSNKLRGFS---GRMNSTQV------RG-KELLPLGPHPE--CKS
  CN38022/1-1295                 SSFLDGSVMYGSTKCEGDRLRTFQ--DGKMKTTRISNSRRHYG-ITLSQSDEAEQDGCVS
  BM45891/1-1491                 TAYLDGSAIYGSTECEMKELRTFV--GGRLNSTNLG----IFN-PEALPQGDQEQD-CRS
  TMP12112/1-740                 TSYIDASNVYGSNDCIASDLRLFS--QGKLNYSRTI-----FGLQQALPFGFRDPD-CKS
  CE43668/1-1537                 TSFLDASTIYGSTQCEANKLRLFS--DGKLNFTDLG-----FN-KEALPQGNQERD-CRS
  OVP00967/1-1231                TSYIDASFIYGSTECEANKLRLFS--QGLLNFTDLG-----FN-REALPQGRQERD-CRS
  PP55795/1-1450                 TAFLDGSVIYGATKCEANHLRMFR--GGLMNFTNLG----HHN-PMALPQGKQEQD-CRS
  SRP05421/1-1534                TSFIDGSAIYGSTDCEANQLRFFS--KGLLKYSNIG----LHN-TEALPQGEQEKD-CRS
  JA48044/1-1261                 TAYVDGSAIYGSTKCEANNLRLFT--RGLLNFTDFG-----HG-QMMLPQGNQEKD-CRS
  CBP00571/1-1491                TAYVDGSAIYGSTKCEAKALRLFT--RGLLNFTDFG-----HG-QMMLPQGNQEKD-CRS
  RP02251/1-1489                 TAYVDGSAIYGSTKCEAKALRLFT--RGLLNFTDFG-----HG-QMMLPQGNQEKD-CRS
                                 : ::*.* :** .      :* :    * :.           .              *  
  
  
  SW:Q3UQ28/1-1475               DENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIAAELLKLNPHWDGDTVYHETRKI
  ENSEMBL:ENSP00000252804/1-1479 DENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRKI
  FLYBASE:CG10211/1-1394         RNGL----CFLGGDDRASEQPGLTAIHTAFLREHNRIVEGLRGVNPHWNGEQLFHHARKI
  CN38022/1-1295                 SPEAP---CFIAGDDRNSQQTLLIAVHTIFHREHERLATLLKEMNPQWEDEQIYQETRKL
  BM45891/1-1491                 KPDFM---CFVAGDERNSHQPGLTSMHNIFLREHNRIARKLEEMNPFWNDERIFQETRRI
  TMP12112/1-740                 HADK----CFLAGDIRVNENSGLMVPHILFVSEHNRIAEKLYHLNSFWSDERIYQETRKI
  CE43668/1-1537                 VLQNRQRRCFVAGDERSNEQPGLTAIHNIFLREHNRIARYLKQINNFWSDEKLFQESRRI
  OVP00967/1-1231                QPRHP---CFNAGDERSNEQPGLTVMHTLFLREHNRIAASLSRINNFWSDEKIYLETRRI
  PP55795/1-1450                 SPKFM---CFVAGDERNSHQPALTVMHNIFLREHNRIATELERLNPQWDDEKIYQETRRI
  SRP05421/1-1534                LPKYK---CFVSGDERNSHQPGLTMMHTIFMREHNRIVKKLSIINPHWNDEKLYQEGRRI
  JA48044/1-1261                 SQEKRSMPCFVAGDERNSHQPGLTVMHTFMVREHNRIAMQLSALNPHWNDDTVFEETRRI
  CBP00571/1-1491                TLEKRSMPCFVAGDERNSHQPGLTIMHTFMVREHNRIAMQLSALNPHWNDDTVFEETRRI
  RP02251/1-1489                 SQEKRSMPCFVAGDERNSHQPGLTIMHTFMVREHNRIAMQLSALNPHWNDDTVFEETRRI
                                         ** .** * ..:  *   *     **:*:.  *  :*  *..: :: . *::
  
  
  SW:Q3UQ28/1-1475               VGAEIQHITYRHWLPKILG-------EVGMKMLGEYRGYDPSVNAGIFNAFATAAFRFGH
  ENSEMBL:ENSP00000252804/1-1479 VGAEIQHITYQHWLPKILG-------EVGMRTLGEYHGYDPGINAGIFNAFATAAFRFGH
  FLYBASE:CG10211/1-1394         VSAQVQHIVFNEFLPRILSWNAVNLYGLKLLPQGYYKDYNPSCSPIVFNEFAAAAFRIGH
  CN38022/1-1295                 ISAQFSHIVYNEYLPIIIGQKLIDEYGLRPKRDGYFTGYEN-CDASILQPFATAAFRFGH
  BM45891/1-1491                 VGAEFAHITYNDYLPLLLGNRLMHKYDLNTHKIGYYHGYDDQCDASISHPFATSAFRFGH
  TMP12112/1-740                 VGAMMQHITFKEWLPKVIGNKLMDVYGLQLKSNGYYDGYDQFCDATIANEFAAAAFRFGH
  CE43668/1-1537                 NIAQLQHIIYKEWLPVVLGCQNMEKWGLMPQTAGYFEGYDDQCDATISQEMSTSAFRFGH
  OVP00967/1-1231                MGAKIQHIVYNEWLPIVLGCEATARYDLVPRKTGYYKGYDDKCDPTMTQEMATAAFRFGH
  PP55795/1-1450                 VAAEFQHITFSEYLPKLIGTRLMAKYDLQPKIDGFFKGYNRSCDASISHPFATAAFRFGH
  SRP05421/1-1534                QIGQFQHIVFSEFIPKIIGIKLLDKYDIMVKKDGYYKKYDETCDPQISQPFATAAYRFGH
  JA48044/1-1261                 VVAEMQHITFAEFLPKIIGLDLLNAENLVPKKNGYFDGYDDTCDASISQPFATAAFRFGH
  CBP00571/1-1491                VVAEMQHITFAEFLPKIIGLDLLNAQNLVPKKNGYFGGYDETCDASISQPFATAAFRFGH
  RP02251/1-1489                 VVAEMQHITFAEFLPKIIGLDLLNAQNLVPKKNGYFGGYDDTCDASISQPFATAAFRFGH
                                   . . ** : .::* ::.        :     * :  *:   .. : : ::::*:*:**
  
  
  SW:Q3UQ28/1-1475               TLINPLLYRLDENFEPIPQGHVPLHKAFF--SPFRIVNEGGIDPLLRGLFGVAGKMRIPS
  ENSEMBL:ENSP00000252804/1-1479 TLVNPLLYRLDENFQPIAQDHLPLHKAFF--SPFRIVNEGGIDPLLRGLFGVAGKMRVPS
  FLYBASE:CG10211/1-1394         SLLRPHIPRLSVQHQPVE-PPLLLRDGFFRMDALLQ--PGIIDEILRGLVATPMET--LD
  CN38022/1-1295                 STVTRFTPMQETVHSPAT-RVVDLASDFLNMSKIYNDDA--VEKILGGMHAKNQMM--TD
  BM45891/1-1491                 TLVRRFFPRFNAFYKNFT-EPIDLVENFNSVEAIYDGKRGSIDSLIIGLLGAPSMA--FD
  TMP12112/1-740                 TLVRDNFHLIHPHYHSFV-DEMRLKHMFFNITPLQQYNNAGMQFMATGLLRTPAMA--FD
  CE43668/1-1537                 SLIRGVFTRMNDNFQNMT-NHVNLTETFSNPSPVYDKNSGHMESILMGLIGANSMA--FD
  OVP00967/1-1231                SLIRNIFPRMNAEYKEET-DGLDLKASFNNETFYYSLETGHIESVIMGLLGSHSMG--FD
  PP55795/1-1450                 TLIRRMFPRMDSAFQNMS-APVDLADHFNNVEPIYDNTAGGMDALLMGLLGTPSMA--FD
  SRP05421/1-1534                TLIRRLFPRLDKNFKEIS-DPIDISTHFGHVEPIYNGTAGGIDSIIMGLLGTPSMA--FD
  JA48044/1-1261                 TLIRRMFPRMNYNYKNMS-EPVDLAQHFGHVGPLYEQDKGGLDAMLMGLLGTPSMA--FD
  CBP00571/1-1491                TLIRRMFPRMNYNYKNMS-EPVDLAQHFGHVGPLYEQEKGGMDAMLMGLLGTPSMA--FD
  RP02251/1-1489                 TLIRRMFPRMNYNYKNMS-EPVDLAQHFGHVGPLYEQEKGGMDAMLMGLLGTPSMA--FD
                                 : :          .       : :   *             :: :  *:          .
  
  
  SW:Q3UQ28/1-1475               QLLNTELTERLFSM--AHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAYTFEDLKN
  ENSEMBL:ENSP00000252804/1-1479 QLLNTELTERLFSM--AHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKN
  FLYBASE:CG10211/1-1394         QFITGEVTNHLFEDRKIPFSGIDLIALNIQRARDHGIPSYNNYRALCNLKRATNWNDLSR
  CN38022/1-1295                 RFVDDAVRNFLFSDRGRRGTGLDLIAINIQRGRDHGIPSYNHFRDFCGFPRLTSFYSIFS
  BM45891/1-1491                 RHITTALRNHLFGRRGEPFSGMDLISLNILRARDHGVQPYNAFRELCGIGKAKDFDDLLN
  TMP12112/1-740                 RYINQDLRNHLFEFKGKPFSGMDLPALNIQRARDHGIPGYNAYREYCGLRKAIYFTDLSD
  CE43668/1-1537                 RHIVTAVRNHLFAKPGGPLTGLDLPAVNIQRGRDHGVQGYNAYRKHCGLRKASAFSDLRD
  OVP00967/1-1231                RYISDAVRNHLFQKSSNPYTGMDLPALNIQRGRDHGIPPYNSYREMCGMHRARNFDDLKD
  PP55795/1-1450                 RHITDAVRNHLFARRGQATSGMDLITINILRARDHGVQPYNDLREFCGLKRARSWGDLSP
  SRP05421/1-1534                RHITSAVRNHLFARRGEKTSGMDLIAINILRARDHGVQSYNTFREFCGFKKATNFNDLLN
  JA48044/1-1261                 RHITDAVRNHLFMRRGEKTSGMDLIVLNILRARDHGVQPYNDLREYCGFKRAVTWDDLRV
  CBP00571/1-1491                RHITDAVRNHLFMRRGEKTSGMDLIVLNILRARDHGVQPYNDLREFCGLRRAVKWEDLRS
  RP02251/1-1489                 RHITDAVRNHLFMRRGEKTSGMDLIVLNILRARDHGVQPYNDLREFCGLRRAVKWDDLKS
                                 : :   : : **        .:**  :** *.****:  *:  *  *.:     : .:  
  
  
  SW:Q3UQ28/1-1475               EIKSPVIREKLQR---------LYGSTLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFR
  ENSEMBL:ENSP00000252804/1-1479 EIKNPEIREKLKR---------LYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFK
  FLYBASE:CG10211/1-1394         EIPTEVI-NRFQK---------IYASVDDIDLFPGAMTERPLQGGLVGPTLACIIGIQFR
  CN38022/1-1295                 DIDQDGL-TAIGK---------VYESPDDIDLFTGIISENVVPGAIVGPTASCIIAEQFR
  BM45891/1-1491                 EMDESAV-IALKN---------LYKTVDDIDLFPGLLCEKPMEDALLPPTMACIIAEQFQ
  TMP12112/1-740                 TMDDDAI-SAFIS---------LYRHVDDIDLFPGLISERPLAGSLVGPTLGCIIGEQMK
  CE43668/1-1537                 VMNSEAV-TALET---------AYAHVDDIDLFPGIMSESPTRGSLVGPTLACLIGEQMQ
  OVP00967/1-1231                VMDDRTI-AAFRN---------VYDHVDDIDLFPGMMSERPLKGALVGPMLTCIIGEQFQ
  PP55795/1-1450                 SMDQTSI-DALRKRSKTTTSHQVYEHVDDIDIFPGLLSETPIKGALMPPTMACIIAEQFE
  SRP05421/1-1534                DMDSETV-FSLQS---------VYEDVNDIDLFPGLISEKPLRGALLGPTMACLIAEQFS
  JA48044/1-1261                 EMDQDNI-NILQT---------LYESVDDVDLFPGLVSERPLRGALLGSTMSCIIAEQFA
  CBP00571/1-1491                EMDQDNI-NILQS---------LYESVDDIDLFPGLVSERPLRGALLGTTMSCIIAEQFG
  RP02251/1-1489                 EMDQDNI-NILQS---------LYESVDDIDLFPGLVSERPLRGALLGTTMSCIIAEQFG
                                  :    :   :            *    ::*:*.. : *    .. : .   *::. *: 
  
  
  SW:Q3UQ28/1-1475               RLRDGDRLWYENPGV---FSPAQLTQLKQTSLARILCDNSDNITRVQQDVFRVA-EFPHG
  ENSEMBL:ENSP00000252804/1-1479 RLRDGDRLWYENPGV---FSPAQLTQIKQTSLARILCDNADNITRVQSDVFRVA-EFPHG
  FLYBASE:CG10211/1-1394         QLRKCDRFWYENQNPEVKFTEAQLAEVRKVTLAKIVCENLEITGDMQRAAFDLPSNFLNP
  CN38022/1-1295                 RLKKCDRFYYENGMEHTKFSTDQLKEIRKVTMSSLICSNTK-IPKISKDVFSVPDPIGNP
  BM45891/1-1491                 RLKKCDRFYYENDLHAIRFSPMQLNEIRKVTLSSLLCANSRMLRNIQPNVFLLPDQFLNA
  TMP12112/1-740                 KLRNCDRFWYENNIAENRFTPGQLAEIRKVTLASIICNNMKKVKRIQPRAFDMPDDFMNA
  CE43668/1-1537                 RLKKCDRFYYETSDSMVRFTPDQLVEIRKASLSRIICDNSEYAANIQPNVFLMPDDLTNS
  OVP00967/1-1231                RLKRCDRFFYENDNPATKFTPDQLAEIRKTTLSKLICANSQYARRIQPNAFLMPDDLTNA
  PP55795/1-1450                 RLKKCDRFYYENDLPYTKFSKEQLNEIRKVTLGSVLCANARSMIKVQPDVFIMPDELTNA
  SRP05421/1-1534                RLKKCDRYYYENNNEVTKFTLRQLREIRKIKLSTIFCQNSNYIKTIQPNVFDMPDDLMNS
  JA48044/1-1261                 RLKRCDRFYYENDNNAAKFTPAQLNEIRKVKLASIFCSNSKYLKTIQPNVFDVTDDLTNA
  CBP00571/1-1491                RLKRCDRFYYENDNNAAKFTPAQLNEIRKVKLASIFCSNSKYMKTIQPNVFDVTDELTNA
  RP02251/1-1489                 RLKKCDRFYYENNNNAAKFTPGQLNEIRKVKLASIFCSNSKYLKTIQPNVFDVTDELTNA
                                 :*:  ** :**.      *:  ** :::: .:. :.* *      :.  .* :.  : : 
  
  
  SW:Q3UQ28/1-1475               YSSCEDIPRVDLRVWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYEDDKPTKRARWRKAL
  ENSEMBL:ENSP00000252804/1-1479 YGSCDEIPRVDLRVWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIP
  FLYBASE:CG10211/1-1394         RVPCASMPQIDLNAWRENVQGCQIGN-------------------------------RNV
  CN38022/1-1295                 IINCDFYSKLDLTKWRDA-QNCIYEN-------------------------------KYI
  BM45891/1-1491                 PISCAHFEHINLEQWIDR-PRCYVGN-------------------------------III
  TMP12112/1-740                 EVDCAGLQQLDITKWLDR-KFCLVKH-------------------------------RVI
  CE43668/1-1537                 PMTCSELSEIDLNKWVER-DYCLVDE-------------------------------RVV
  OVP00967/1-1231                PMKCSELSDIDLYEWLDR-QFCVVDH-------------------------------RVI
  PP55795/1-1450                 QVPCRDFLKLDLKPWTDR-PTCFIDD-------------------------------RHV
  SRP05421/1-1534                LVDCENLGKINLNEWKED-LSCQIKD-------------------------------KEI
  JA48044/1-1261                 QVPCSDIPQIDISLWKER-KTCEMNG-------------------------------RSI
  CBP00571/1-1491                QVPCSDIPQVDLSLWKER-KTCEMNG-------------------------------RSI
  RP02251/1-1489                 QVPCSDIPQVDLSLWKER-KTCEMNG-------------------------------RSI
                                    *     :::  * :    *                                      
  
  
  SW:Q3UQ28/1-1475               SVKH-GKHLSNATSATHEHLEGPATNDLKEFVLEMQKIITDLRKQINSLESRLSTTECVD
  ENSEMBL:ENSP00000252804/1-1479 SVGRQGEHLSNSTSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVD
  FLYBASE:CG10211/1-1394         RVGE-SAFPSPCTSCVCS-AEGAQCASLR-------------ITDCGQLIRQWPKEAILR
  CN38022/1-1295                 PLHT-AVEISPCTKCICS-SDG--------------------------------------
  BM45891/1-1491                 APDE-IKRISPCQSCTCT-DNGSQCDTIT-------------IRNCIALFSQYPFDEIMK
  TMP12112/1-740                 NMGK-TKSISPCVSCTCT-HYGTYCQAKR-------------IENCDSLMNRYLISEVQD
  CE43668/1-1537                 NRGK-TKRITPCITCTCT-LEGPECHSIT-------------IDDCSRLLRDYSITDIQK
  OVP00967/1-1231                NLGR-TKRITPCITCTCT-AEGPECHSMV-------------IDRCESLLTDYLFSEVIA
  PP55795/1-1450                 VRGE-SMQKSPCLSCTCT-ADGPRCRSLI-------------VANCKQLLKDFTIEEVKK
  SRP05421/1-1534                ELGK-TIDITPCVSCTCT-KDGTICHPKK-------------IINCEKLLSMFSKNEILN
  JA48044/1-1261                 ALGD-SVHMTPCVTCTCT-LEGVTCNPTK-------------VDSCEKLTHKYLITDIAK
  CBP00571/1-1491                ALGD-SVHMTPCVTCTCT-LEGVACNPTK-------------VDSCEKLTHKYLLTDIAK
  RP02251/1-1489                 ALGD-SVHMTPCVTCTCT-LEGVACNPTK-------------VDSCEKLTHKYLLTDIAK
                                          : . ..      .                                      
  
  
  SW:Q3UQ28/1-1475               DSGESHGGNTKWKKDPCTVCECKNGQITCFVEACQPAACPQPVKVEGACCPVCLK-----
  ENSEMBL:ENSP00000252804/1-1479 AGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQ-----
  FLYBASE:CG10211/1-1394         DE-------------------------VCNSQ-----------------CGIYLTGQQAS
  CN38022/1-1295                 DP-------------------------VCFMQ-----------------CAHRIR-----
  BM45891/1-1491                 DT-------------------------ACIVQ-----------------CAHLLR-----
  TMP12112/1-740                 DT-------------------------ACVIQ-----------------CSGAIQ-----
  CE43668/1-1537                 DP-------------------------VCLIQ-----------------CSQQLK-----
  OVP00967/1-1231                DT-------------------------VCVIQ-----------------CSSLIR-----
  PP55795/1-1450                 DM-------------------------SCVIQ-----------------CATLIK-----
  SRP05421/1-1534                DT-------------------------SCIIQ-----------------CSILLK-----
  JA48044/1-1261                 DT-------------------------SCMIQ-----------------CTDYMK-----
  CBP00571/1-1491                DT-------------------------SCMIQ-----------------CTDYMK-----
  RP02251/1-1489                 DT-------------------------SCMIQ-----------------CTDYMK-----
                                                             *  :                 *   :      
  
  
  SW:Q3UQ28/1-1475               ---------------NTAEEKP--------------
  ENSEMBL:ENSP00000252804/1-1479 ---------------KRAEEKP--------------
  FLYBASE:CG10211/1-1394         GFNPQQRQGQAQPRVTRSRNQNLFKFPDLTPFIASL
  CN38022/1-1295                 ---------------DNY------------------
  BM45891/1-1491                 ---------------EPK------------------
  TMP12112/1-740                 ---------------KRLSHQTKNDKPAELDEAFHL
  CE43668/1-1537                 ---------------KL-------------------
  OVP00967/1-1231                ---------------QRSR---------------QL
  PP55795/1-1450                 ---------------ERTN---------------DF
  SRP05421/1-1534                ---------------K--------------------
  JA48044/1-1261                 ---------------RV-------------------
  CBP00571/1-1491                ---------------RV-------------------
  RP02251/1-1489                 ---------------RV-------------------