Served from Datomic
Sequence:
download
CE29545sequence.fasta
>ABI-1 MSVNDLQELIERRIPDNRAQLETSHANLQQVAAYCEDNYIQSNNKSAALEESKKFAIQALASVAYQINKMVTDLHDMLAL QTDKVNSLTNQVQYVSQVVDVHKEKLARREIGSLTTNKTLFKQPKIIAPAIPDEKQRYQRTPIDFSVLDGIGHGVRTSDP PRAAPISRATSSISGSSPSQFHNESPAYGVYAGERTATLGRTMRPYAPSIAPSDYRLPQVTPQSESRIGRQMSHGSEFGD HMSGGGGSGSQHGSSDYNSIYQPDRYGTIRAGGRTTVDGSFSIPRLSSAQSSAGGPESPTFPLPPPAMNYTGYVAPGSVV QQQQQQQMQQQNYGTIRKSTVNRHDLPPPPNSLLTGMSSRMPTQDDMDDLPPPPESVGGSSAYGVFAGRTESYSSSQPPS LFDTSAGWMPNEYLEKVRVLYDYDAAKEDELTLRENAIVYVLKKNDDDWYEGVLDGVTGLFPGNYVVPV
view sequence (469 aa)
>ABI-1
MSVNDLQELIERRIPDNRAQLETSHANLQQVAAYCEDNYIQSNNKSAALEESKKFAIQALASVAYQINKMVTDLHDMLAL
QTDKVNSLTNQVQYVSQVVDVHKEKLARREIGSLTTNKTLFKQPKIIAPAIPDEKQRYQRTPIDFSVLDGIGHGVRTSDP
PRAAPISRATSSISGSSPSQFHNESPAYGVYAGERTATLGRTMRPYAPSIAPSDYRLPQVTPQSESRIGRQMSHGSEFGD
HMSGGGGSGSQHGSSDYNSIYQPDRYGTIRAGGRTTVDGSFSIPRLSSAQSSAGGPESPTFPLPPPAMNYTGYVAPGSVV
QQQQQQQMQQQNYGTIRKSTVNRHDLPPPPNSLLTGMSSRMPTQDDMDDLPPPPESVGGSSAYGVFAGRTESYSSSQPPS
LFDTSAGWMPNEYLEKVRVLYDYDAAKEDELTLRENAIVYVLKKNDDDWYEGVLDGVTGLFPGNYVVPV
Estimated Isoelectric Point:
5.55457305908203
Estimated Molecular Weight:
51.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys16
Gln33
Leu30
Gly36
Met12
Ser52
Tyr23
His9
Glu22
Arg26
Cys1
Phe10
Pro38
Val30
Asn20
Ala33
Ile20
Trp2
Asp29